Recombinant Human N-Acetylglucosamine-6-Sulfatase/GNS (C-6His)

  • Catalog number
    C354-500
  • Price
    Please ask
  • Size
    500 ug
  • Description
    Recombinant Human N-Acetylglucosamine-6-Sulfatase is produced by our Mammalian expression system and the target gene encoding Val37-Leu552 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    VFGVAAGTRRPNVVLLLTDDQDEVLGGMTPLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQEPNTFPAILRSMCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTLLSVDDLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLVANIDLGPTILDIAGYDLNKTQMDGMSLLPILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRFSKHLLVDHHHHHH
  • Estimated molecular weight
    59,35 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Dry Ice/ice packs
  • Package form
    Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 150mM NaCl,10% Glycerol,pH 8.0.
  • Storage conditions
    Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P15586
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    GNS, MIR1302-6, PIRC28, PIRC24, PIRC26, PIRC27, PIRC25, ADCP1
  • Short name
    Recombinant N-Acetylglucosamine-6-Sulfatase/GNS (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Recombinant Human GNS(C-6His)
  • Alternative technique
    rec
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 28
  • Locus
    6
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 24
  • Locus
    6
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 26
  • Locus
    6
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 27
  • Locus
    6
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 25
  • Locus
    6
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    adenosine deaminase complexing protein 1
  • Locus
    6
  • Discovery year
    1986-01-01
  • Entrez gene record
    106
  • Pubmed identfication
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee