Recombinant Human Mitochondrial Fission 1 Protein/FIS1 (C-6His)

  • Catalog number
    CF28-50
  • Price
    Please ask
  • Size
    50 ug
  • Description
    Recombinant Human Mitochondrial Fission 1 Protein is produced by our E.coli expression system and the target gene encoding Met1-Gly122 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGVEHHHHHH
  • Estimated molecular weight
    15,2 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM Tris, pH 8.0.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    Q9Y3D6
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    FIS1
  • Short name
    Recombinant Mitochondrial Fission 1 Protein/FIS1 (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human Mitochondrial Fission 1 Protein/FIS1(C-6His)
  • Alternative technique
    rec
  • Alternative to gene target
    fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae), FIS1 and IDBG-234267 and ENSG00000214253 and 51024, protein binding, Plasma membranes, Fis1 and IDBG-204681 and ENSMUSG00000019054 and 66437, FIS1 and IDBG-640356 and ENSBTAG00000007900 and 615565
  • Tissue
    mitochondrial
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: An in vitro allergen radioimmunoassay in which allergens are coupled to an immunosorbent. The coupled allergens bind the IgE in the sera of patients which in turn binds radioisotope-labeled anti-IMMUNOGLOBULIN E antibodies.
  • Tree numbers
    • E01.370.225.812.735.830
    • E05.200.812.735.830
    • E05.478.566.380.810
    • E05.478.566.639.810
    • E05.478.594.760.830
    • E05.601.470.380.810
    • E05.601.470.639.810
  • Qualifiers
    ethics, mortality, psychology, trends, veterinary, history, classification, economics, instrumentation, methods, nursing, standards, adverse effects, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee