Recombinant Human Lymphotactin/LTN/XCL1 (C-Fc-6His)

• Catalog number
  CC33-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Human Lymphotactin is produced by our Mammalian expression system and the target gene encoding Val22-Gly114 is expressed with a Fc, 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human Cells
• Peptide sequence
  VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
• Estimated molecular weight
  40,4 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4 .
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  P47992
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Lymphotactin/LTN/XCL1   C-Fc-6His  
• Gene symbol
  XCL1
• Short name
  Recombinant Lymphotactin/LTN/XCL1 (C-Fc-6His)
• Technique
  Recombinant, FC, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human Lymphotactin/Lptn/XCL1(C-Fc-6His)
• Alternative technique
  rec
• Alternative to gene target
  chemokine (C motif) ligand 1, ATAC and LPTN and LTN and SCM-1 and SCM-1a and SCM1 and SCM1A and SCYC1, XCL1 and IDBG-104633 and ENSG00000143184 and 6375, protein homodimerization activity, Extracellular

Gene info

• Identity
  HGNC:10645
• Gene
  XCL1
• Long gene name
  X-C motif chemokine ligand 1
• Synonyms gene
  • LTN
  • SCYC1
• Synonyms gene name
  • small inducible cytokine subfamily C, member 1 (lymphotactin)
  • chemokine (C motif) ligand 1
• Synonyms
  • LPTN
  • ATAC
  • SCM-1a
  • SCM-1
• Synonyms name
  • lymphotactin
• GenBank acession
  • D43768
• Locus
  1q24.2
• Discovery year
  1996-03-19
• Entrez gene record
  6375
• Pubmed identfication
  • 7602097
  • 7875320
• RefSeq identity
  • NM_002995
• Classification
  • Chemokine ligands
• VEGA ID
  OTTHUMG00000034548

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products