Recombinant Human Lymphocyte Antigen 6H/LY6H (C-6His)

• Catalog number
  CA64-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Human Lymphocyte Antigen 6H is produced by our Mammalian expression system and the target gene encoding Leu26-Gly115 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGLDHHHHHH
• Estimated molecular weight
  10,9 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  O94772
• Other related products
• Additional description
  Antigens are peptides or recombinant or native dependent on the production method.
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Lymphocyte   6H/LY6H   C-6His  
• Gene symbol
  LY6H
• Short name
  Recombinant Lymphocyte Antigen 6H/LY6H (C-6His)
• Technique
  Recombinant, antigen, antigenes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human Lymphocyte Antigen 6H/LY6H(C-6His)
• Alternative technique
  rec, antigenes
• Alternative to gene target
  lymphocyte antigen 6 complex, locus H, NMLY6, LY6H and IDBG-38152 and ENSG00000176956 and 4062, Plasma membranes, Ly6h and IDBG-150907 and ENSMUSG00000022577 and 23934, BT.104308 and IDBG-643841 and ENSBTAG00000011939 and 618749
• Tissue
  lymphocyte

Gene info

• Identity
  HGNC:6728
• Gene
  LY6H
• Long gene name
  lymphocyte antigen 6 family member H
• Synonyms gene name
  • lymphocyte antigen 6 complex, locus H
• Synonyms
  • NMLY6
• GenBank acession
  • AB012293
• Locus
  8q24.3
• Discovery year
  1998-06-19
• Entrez gene record
  4062
• Pubmed identfication
  • 9799603
• Classification
  • LY6/PLAUR domain containing
• VEGA ID
  OTTHUMG00000154890

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products