Recombinant Human Islet cell autoantigen 1(ICA1),partial

  • Catalog number
    RPC20230
  • Price
    Please ask
  • Size
    500 μg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    Q05084
  • Gene number
    ICA1
  • Other name
    69 kDa islet cell autoantigen ; ICA69Islet cell autoantigen p69 ; ICAp69 ; p69
  • Protein origin
    Yeast
  • Protein region
    1-268aa
  • Protein sequence
    MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLK
  • Information about sequence
    Partial
  • Expected molecular weight
    33.5kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    For cells, cell lines and tissues in culture till half confluency.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    ICA1-AS1, ICA1
  • Short name
    Recombinant Islet autoantigen 1(ICA1),partial
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-tagged
  • Species
    Human, Humans
  • Alternative name
    Rec. H. sapiens Islet cellular autoantigen 1(islet cell autoantigen 1, 69kDa),partial
  • Alternative technique
    rec
  • Alternative to gene target
    islet cell autoantigen 1, 69kDa, ICA69 and ICAp69, ICA1 and IDBG-8551 and ENSG00000003147 and 3382, protein domain specific binding, Cell surfaces, Ica1 and IDBG-128452 and ENSMUSG00000062995 and 15893, BT.35115 and IDBG-629525 and ENSBTAG00000000799 and 535346
  • Tissue
    cell
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee