Recombinant Human Interleukin 21 IL-21

4x Recombinant Human Interleukin 21 IL-21 found in novo

  • Description
    Recombinant Human Interleukin-21 is produced by our E.coli expression system and the target gene encoding Gln23-Ser155 is expressed.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    MQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
  • Estimated molecular weight
    15,6 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.2.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    Q9HBE4
  • Gene target
  • Short name
    Recombinant Interleukin-21/IL-21
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    recombinant H. sapiens Interleukin-21/Interleukin-21
  • Alternative technique
    rec

CC45-1000 | Recombinant Human Interleukin-21/IL-211 mg 3033.67 USD

Ajax processing

CC45-10 | Recombinant Human Interleukin-21/IL-2110 ug 247.72 USD

Ajax processing

CC45-50 | Recombinant Human Interleukin-21/IL-2150 ug 606.49 USD

Ajax processing

CC45-500 | Recombinant Human Interleukin-21/IL-21500 ug 2142.85 USD

Ajax processing
Simillar products
Supplier:aviva
Price:517.41USD
Supplier:quantichrom
Price:541.81USD
Supplier:GENTAUR IHC Stains
Price:302.63USD
Supplier:MBS Recombinant
Price:2 717.61USD
Supplier:bioassay
Price:879.35USD
Supplier:aviva
Price:381.95USD
Supplier:MBS Recombinant
Price:1 671.81USD
Supplier:ABM CrispR
Price:7 103.37USD
Supplier:abbex
Price:995.76USD
Supplier:MBS Polyclonals
Price:364.87USD
Supplier:acr
Price:1 122.68USD
Supplier:MBS Monoclonals
Price:768.79USD
Supplier:Zyagen
Price:248.94USD
Supplier:abbex
Price:724.86USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Recombinant Human Interleukin 21 IL-21 - Gentaur.com
Contact
Chat with gentaur.com employee