Recombinant Human Interleukin 21 IL-21

Recombinant Human Interleukin 21 IL-21 is available 4 times from Novo labs

CC45-10 | Recombinant Human Interleukin-21/IL-21size: 10 ug | 236.45 USD

Ajax processing

CC45-500 | Recombinant Human Interleukin-21/IL-21size: 500 ug | 2045.39 USD

Ajax processing

CC45-50 | Recombinant Human Interleukin-21/IL-21size: 50 ug | 578.91 USD

Ajax processing

CC45-1000 | Recombinant Human Interleukin-21/IL-21size: 1 mg | 2895.69 USD

Ajax processing
  • Description
    Recombinant Human Interleukin-21 is produced by our E.coli expression system and the target gene encoding Gln23-Ser155 is expressed.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    MQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
  • Estimated molecular weight
    15,6 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.2.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    Q9HBE4
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Interleukin-21/IL-21
  • Technique
    Recombinant
  • Species
    Human
  • Alternative name
    recombinant H. sapiens Interleukin-21/Interleukin-21
  • Alternative technique
    rec
Simillar products
Supplier:novo
Price:236.45USD
Supplier:novo
Price:236.45USD
Supplier:novo
Price:236.45USD
Supplier:MyBioSource
Price:0.00USD
Supplier:novo
Price:236.45USD
Supplier:SAB
Price:321.48USD
Supplier:novo
Price:182.87USD
Supplier:novo
Price:196.85USD
Supplier:MyBioSource
Price:0.00USD
Supplier:MyBioSource
Price:0.00USD
Supplier:MyBioSource
Price:0.00USD
Supplier:genways
Price:485.72USD
Supplier:novo
Price:236.45USD
Supplier:MyBioSource
Price:0.00USD
Supplier:Gentaur Genprice
Price:476.40USD
Supplier:novo
Price:236.45USD
Supplier:MyBioSource
Price:0.00USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Recombinant Human Interleukin 21 IL-21 - Gentaur.com
Contact
Chat with gentaur.com employee