Recombinant Human Interferon a2A Variant Lys46 IFN a2A

4x Recombinant Human Interferon a2A Variant Lys46 IFN a2A found in novo

  • Description
    Recombinant Human Interferon alpha-2a is produced by our E.coli expression system and the target gene encoding Cys24-Glu188 is expressed.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    MCDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
  • Estimated molecular weight
    19,24 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P01563
  • Gene target
  • Short name
    Recombinant Interferon a2A Variant (Lys46)/IFN-a2A
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    recombinant H. sapiens Interferon a2A Variant (Lys46)/Interferon-a2A
  • Alternative technique
    rec

C025-50 | Recombinant Human Interferon a2A Variant (Lys46)/IFN-a2A50 ug 235.52 USD

  • Catalog number
    C025-50
  • Supplier
  • Price
    235.52 USD
  • Size
    50 ug
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
1. Gene info
MeSH Data
  • Name
  • Concept
    Scope note:The assay of INTERFERON-GAMMA released from lymphocytes after their exposure to a specific test antigen, to check for IMMUNOLOGIC MEMORY resulting from a previous exposure to the antigen. The amount of interferon-gamma released is usually assayed by an ENZYME-LINKED IMMUNOSORBENT ASSAY.
  • Tree numbers
    • E01.370.225.812.453
    • E05.200.812.453
    • E05.478.594.475
  • Qualifiers
    classification, economics, history, instrumentation, methods, standards, trends, utilization, veterinary, statistics & numerical data, ethics

C025-10 | Recombinant Human Interferon a2A Variant (Lys46)/IFN-a2A10 ug 123.25 USD

Ajax processing

C025-500 | Recombinant Human Interferon a2A Variant (Lys46)/IFN-a2A500 ug 538.15 USD

Ajax processing

C025-1000 | Recombinant Human Interferon a2A Variant (Lys46)/IFN-a2A1 mg 743.16 USD

Ajax processing
Simillar products
Supplier:boster
Price:456.39USD
Supplier:abbex
Price:350.23USD
Supplier:Bioss Primary Conjugated Antibodies
Price:406.36USD
Supplier:ABM microrna
Price:1 732.83USD
Supplier:ABM microrna
Price:1 588.83USD
Supplier:Bioss Primary Conjugated Antibodies. ALEXA FLUOR
Price:406.05USD
Supplier:trca
Price:194.03USD
Supplier:MBS Polyclonals
Price:613.81USD
Supplier:MBS Recombinant
Price:1 914.65USD
Supplier:abbex
Price:641.88USD
Supplier:SFC
Price:0.00USD
Supplier:trca
Price:140.33USD
Supplier:abbex
Price:850.55USD
Supplier:ABM microrna
Price:2 655.37USD
Supplier:MBS Recombinant
Price:1 962.24USD
Supplier:aviva
Price:779.77USD
Supplier:ABM microrna
Price:205.01USD
Supplier:ABM microrna
Price:5 250.95USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Recombinant Human Interferon a2A Variant Lys46 I|gentaur.com
Contact
Chat with gentaur.com employee