Recombinant Human PRV1/CD177(C-6His)

• Catalog number
  C442-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Human CD177 is produced by our Mammalian expression system and the target gene encoding Leu22-Gly407 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human Cells
• Peptide sequence
  LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGTTHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEGVDHHHHHH
• Estimated molecular weight
  42,33 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q8N6Q3
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  PRV1/CD177   C-6His  
• Gene symbol
  CD177
• Short name
  Recombinant PRV1/CD177(C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human CD177/PRV1(C-6His)
• Alternative technique
  rec
• Alternative to gene target
  CD177 molecule, CD177 and IDBG-55103 and ENSG00000204936 and 57126, Plasma membranes, Cd177 and IDBG-155436 and ENSMUSG00000052212 and 68891, BT.78171 and IDBG-638968 and ENSBTAG00000002976 and 616350

Gene info

• Identity
  HGNC:30072
• Gene
  CD177
• Long gene name
  CD177 molecule
• Synonyms gene name
  • CD177 antigen
• Synonyms
  • PRV1
  • HNA2A
  • NB1
• Synonyms name
  • polycythemia rubra vera 1
• GenBank acession
  • AF146747
• Locus
  19q13.31
• Discovery year
  2005-08-12
• Entrez gene record
  57126
• Pubmed identfication
  • 10753836
  • 5552408
• RefSeq identity
  • NM_020406
• Classification
  • CD molecules
  • LY6/PLAUR domain containing
• VEGA ID
  OTTHUMG00000185320

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products