Recombinant Human IL-20 receptor subunit beta/IL-20RB (C-Fc)

  • Catalog number
    CC41-500
  • Price
    Please ask
  • Size
    500 ug
  • Description
    Recombinant Human Interleukin-20 receptor subunit beta/IL-20RB is produced by our Mammalian expression system and the target gene encoding Asp30-Ala230 is expressed with a Fc tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
  • Estimated molecular weight
    49,6 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4 .
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    Q6UXL0
  • Other related products
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Additional description
    The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    IL-20   receptor   subunit   beta/IL-20RB   C-Fc  
  • Gene symbol
    IL20, IL20RB, IL17B, IL36G, IL25, IL22, IL18, IL37, IL6R, IL17C
  • Short name
    Recombinant IL-20 receptor subunit beta/IL-20RB (C-Fc)
  • Technique
    Recombinant, FC, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Recombinant Human IL-20RB (C-Fc)
  • Alternative technique
    rec
Gene info
Gene info
  • Identity
    HGNC:6004
  • Gene
    IL20RB
  • Long gene name
    interleukin 20 receptor subunit beta
  • Synonyms gene
  • Synonyms gene name
    • fibronectin type III domain containing 6
    • interleukin 20 receptor beta
    • interleukin 20 receptor beta subunit
  • Synonyms
  • GenBank acession
  • Locus
    3q22.3
  • Discovery year
    2000-05-23
  • Entrez gene record
    53833
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Interleukin receptors
    • Fibronectin type III domain containing
  • VEGA ID
    OTTHUMG00000159779
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
    Primary Cell Culture
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Gamma-aminobutyric acid receptor subunit beta (gab-1)-E. coli
Catalog number: GEN1015717.E.coli
Size: 1000ug
Price: Please ask
Gamma-aminobutyric acid receptor subunit beta (gab-1)-Yeast
Catalog number: GEN1015717.Yeast
Size: 1000ug
Price: Please ask
Xenopus laevis Acetylcholine receptor subunit beta (chrnb1)-Yeast
Catalog number: GEN1131354.Yeast
Size: 1000ug
Price: Please ask
Electrophorus electricus Acetylcholine receptor subunit beta (chrnb1)-Yeast
Catalog number: GEN1205662.Yeast
Size: 1000ug
Price: Please ask
Filters
Recombinant IL 20 receptor subunit beta IL 20RB C Fc)
Contact
Back
Chat with gentaur.com employee