Recombinant Human IgG1 Fc/IGHG1

• Catalog number
  CD82-50
• Price
  Please ask
• Size
  50 ug

• Description
  Recombinant Human Immunoglobulin G1 Fc is produced by our Mammalian expression system and the target gene encoding Asp104-Lys330 is expressed.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  GSGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Estimated molecular weight
  25,9 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  P01857
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  IgG1   Fc/IGHG1  
• Gene symbol
  IGHG1
• Short name
  Recombinant IgG1 Fc/IGHG1
• Technique
  Recombinant, FC, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Isotype
  IgG1
• Species
  Human, Humans
• Alternative name
  Human IgG1 Fc/IGHG1
• Alternative technique
  rec
• Alternative to gene target
  immunoglobulin heavy constant gamma 1 (G1m marker), IGHG1 and IDBG-124377 and ENSG00000211896 and 102723479,102725426,102725526, protein binding, Extracellular

Gene info

• Identity
  HGNC:5525
• Gene
  IGHG1
• Long gene name
  immunoglobulin heavy constant gamma 1 (G1m marker)
• GenBank acession
  • J00228
• Locus
  14q32.33
• Discovery year
  2001-06-22
• Entrez gene record
  3500
• RefSeq identity
  • NG_001019
• Classification
  • Immunoglobulin heavy locus at 14q32.33
• VEGA ID
  OTTHUMG00000152495

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products