Recombinant Human HtrA4, truncated, His - tagged (Recombinant Protein)

• Catalog number
  30 600 412
• Price
  Please ask
• Size
  5 µg/ 50 µl

• Protein type
  Recombinant
• Protein subtype
  EC 3.4.21.108
• Protein family
  Member of the trypsin family of serine proteases
• Protein description
  Based on studies on other related family members, HtrA4 may function as a secreted oligomeric chaperone protease to degrade misfolded secretory proteins
• Research area interests
  N/A
• Package form
  liquid
• Tested applications
  Characterization of structure and function; Screening of inhibitors; Standard in enzymatic and immunologiacal assays
• Other names
  High-Temperature Requirement Factor A4
• Peptide sequence
  MRLGKVPAVPVQWGNCGDTGTRSAGPLRRNYNFIAAVVEKVAPSVVHVQLWGRLLHGSRLVPVYSGSGFIVSEDGLIITNAHVVRNQQWIEVVLQNGARYEAVVKDIDLKLDLAVIKIESNAELPVLMLGRSSDLRAGEFVVALGSPFSLQNTATAGIVSTKQRGGKELGMKDSDMDYVQIDATINYGNSGGPLVNLDGDVIGVNSLRVTDGISFAIPSDRVRQFLAEYHEHQMKGKAFSNKKYLGLQMLSLTVPLSEELKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTDVVKALDSDSLSMAVLRGKDNLLLTVIPETINHHHHHH
• Available target modification
  No
• Expression system
  E.coli
• Product Subtype
  protein fragment
• Active form
  Yes
• Tag
  His-tagged
• Contents
  120 mM NaCl, 120 mM Imidazol, 15 % (v/v) Glycerol, 40 mM Tris-HCl, pH 7.5
• Protein purity
  > 90 %
• Molecular weight
  38 kDa
• UniProt number
  P83105
• Gene number
  203100
• Abbreviation
  HTRA4 (partial)
• Full name
  HtrA serine peptidase 4 (partial)
• Other desciption
  Recombinant human HtrA4 (amino acids 138 – 476, BC057765) is expressed in E. coli.
• Purification
  Mentioned in the data sheet
• PubMed citations
  See the data sheet
• Warnings
  For Research Use only.
• Shipping conditions
  dry ice
• Storage condition
  Store at -70°C
• Technical datasheet
  Contact us to receive the datasheet
• Representative figure
  more details
• Other products
• Conjugation
  histidine
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  HtrA4   truncated   His    tagged   Protein  
• Short name
  Recombinant HtrA4, truncated, His - tagged (Recombinant Protein)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. biotez advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Label
  His
• Species
  Homo sapiens, Humans
• Alternative name
  Rec. H. sapiens HtrA4, truncated, histidine - tagged (Rec. Protein)
• Alternative technique
  rec

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products