Recombinant Human High Mobility Group Protein B1/HMGB1 (C-6His)

• Catalog number
  C357-50
• Price
  Please ask
• Size
  50 ug

• Description
  Recombinant Human High Mobility Group Protein B1 is produced by our Mammalian expression system and the target gene encoding Gly2-Glu215 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDEVDHHHHHH
• Estimated molecular weight
  25,93 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT, 10% Glycerol, pH 7.4.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  P09429
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Mobility   Group   Protein   B1/HMGB1   C-6His  
• Gene symbol
  HMGB1
• Short name
  Recombinant Mobility Group Protein B1/HMGB1 (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human High Mobility Group Protein B1/HMGB1(C-6His)
• Alternative technique
  rec
• Alternative to gene target
  high mobility group box 1, HMG1 and HMG3 and SBP-1, HMGB1 and IDBG-21100 and ENSG00000189403 and 3146, DNA binding, nuclei, Hmgb1 and IDBG-209311 and ENSMUSG00000066551 and 100862258,102642363,15289,619937, HMGB1 and IDBG-630533 and ENSBTAG00000018103 and 282691

Gene info

• Identity
  HGNC:4983
• Gene
  HMGB1
• Long gene name
  high mobility group box 1
• Synonyms gene
  • HMG1
• Synonyms gene name
  • high-mobility group (nonhistone chromosomal) protein 1
  • high-mobility group box 1
• Synonyms
  • HMG3
  • SBP-1
  • DKFZp686A04236
• Synonyms name
  • Sulfoglucuronyl carbohydrate binding protein
  • Amphoterin
  • high mobility group protein 1
• GenBank acession
  • D63874
• Locus
  13q12.3
• Discovery year
  1993-12-13
• Entrez gene record
  3146
• Pubmed identfication
  • 8661151
  • 11279268
• RefSeq identity
  • NM_002128
• Classification
  • Canonical high mobility group
• VEGA ID
  OTTHUMG00000016670

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products