Recombinant Human Fc ? RIIIA/FCGR3A/CD16a (C-6His,Val176Phe)

• Catalog number
  CS11-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Human Fc gamma RIIIA is produced by our Mammalian expression system and the target gene encoding Gly17-Gln208(Val176Phe) is expressed fused with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQHHHHHH
• Estimated molecular weight
  22.7
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  P08637
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  RIIIA/FCGR3A/CD16a   C-6His   Val176Phe  
• Gene symbol
  FCGR3A
• Short name
  Recombinant Fc ? RIIIA/FCGR3A/CD16a (C-6His Val176Phe)
• Technique
  Recombinant, FC, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Recombinant Human Fc gamma RIIIA(C-6His,Val176Phe)
• Alternative technique
  rec
• Alternative to gene target
  Fc fragment of IgG, low affinity IIIa, receptor (CD16a), CD16 and CD16A and FCG3 and FCGR3 and FCGRIII and FCR-10 and FCRIII and FCRIIIA and IGFR3 and IMD20, FCGR3A and IDBG-104292 and ENSG00000203747 and 2214, IgG binding, Cell surfaces

Gene info

• Identity
  HGNC:3619
• Gene
  FCGR3A
• Long gene name
  Fc gamma receptor IIIa
• Synonyms gene
  • FCGR3
  • FCG3
• Synonyms gene name
  • Fc fragment of IgG, low affinity IIIa, receptor for (CD16)
  • Fc fragment of IgG, low affinity IIIa, receptor (CD16a)
  • Fc fragment of IgG receptor IIIa
• Synonyms
  • CD16
  • CD16a
  • FcgammaRIIIa
  • FcGRIIIA
• GenBank acession
  • BC036723
• Locus
  1q23.3
• Discovery year
  1988-11-30
• Entrez gene record
  2214
• Pubmed identfication
  • 2139735
  • 11835346
  • 19309690
• RefSeq identity
  • NM_000569
• Classification
  • Immunoglobulin like domain containing
  • CD molecules
• VEGA ID
  OTTHUMG00000034466
• Locus Specific Databases
  • FCGR3Abase: Mutation registry for Natural killer cell deficiency
  • LRG_60

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products