Recombinant Human Fas/TNFRSF6/CD95 (C-6His)
-
Catalog number
CB72-10
-
Price
Please ask
-
Size
10 ug
-
-
Description
Recombinant Human Fas is produced by our Mammalian expression system and the target gene encoding Gln26-Asn173 is expressed with a 6His tag at the C-terminus.
-
Species reactivity
Human
-
Origin
Human cells
-
Peptide sequence
QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNVDHHHHHH
-
Estimated molecular weight
17,6 kDa
-
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
-
Shipping condition
Ambient/Room Temperature
-
Package form
Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl, pH 7.4.
-
Storage conditions
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
-
Reconstitution conditions
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
-
UniProt number
P25445
-
-
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
Source
Recombinants or rec. proteins
-
Group
recombinants
-
Gene target
-
Gene symbol
FAS
-
Short name
Recombinant Fas/TNFRSF6/CD95 (C-6His)
-
Technique
Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
-
Species
Human, Humans
-
Alternative name
Human CD95/Fas/TNFRSF6(C-6His)
-
Alternative technique
rec
-
Alternative to gene target
Fas (TNF receptor superfamily, member 6), ALPS1A and APO-1 and APT1 and CD95 and FAS1 and FASTM and TNFRSF6, FAS and IDBG-81669 and ENSG00000026103 and 355, identical protein binding, nuclei, Fas and IDBG-159577 and ENSMUSG00000024778 and 14102, FAS and IDBG-637356 and ENSBTAG00000010785 and 282488
-
Gene info
MeSH Data
-
Name
-
Concept
Scope note:
The initial culturing of cells derived directly from fresh TISSUES.
-
Tree numbers
- E01.370.225.500.223.500
- E05.200.500.265.500
- E05.242.223.500
- E05.481.500.249.500
-
Qualifiers
ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products