Recombinant Human Palmitoyl-Protein Thioesterase 1/PPT1 (C-6His)

• Catalog number
  CC64-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Human Palmitoyl-protein thioesterase 1 is produced by our Mammalian expression system and the target gene encoding Asp28-Gly306 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  DPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHIIPFLGVDHHHHHH
• Estimated molecular weight
  32,3 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 20mM TrisHCl,150mM NaCl,10%Glycerol,pH7.5.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  P50897
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Palmitoyl-Protein   Thioesterase   1/PPT1   C-6His  
• Gene symbol
  PPT1
• Short name
  Recombinant Palmitoyl-Protein Thioesterase 1/PPT1 (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human Palmitoyl-protein thioesterase 1/PPT1(C-6His)
• Alternative technique
  rec
• Alternative to gene target
  palmitoyl-protein thioesterase 1, CLN1 and INCL and PPT, PPT1 and IDBG-96867 and ENSG00000131238 and 5538, palmitoyl-CoA hydrolase activity, nuclei, Ppt1 and IDBG-184539 and ENSMUSG00000028657 and 19063, BT.101768 and IDBG-640822 and ENSBTAG00000013367 and 281421

Gene info

• Identity
  HGNC:9325
• Gene
  PPT1
• Long gene name
  palmitoyl-protein thioesterase 1
• Synonyms gene
  • PPT
• Synonyms
  • CLN1
  • INCL
• Synonyms name
  • ceroid-lipofuscinosis, neuronal 1, infantile
• GenBank acession
  • U44772
• Locus
  1p34.2
• Discovery year
  2000-06-09
• Entrez gene record
  5538
• Pubmed identfication
  • 7637805
  • 8325646
• RefSeq identity
  • NM_000310
• Classification
  • Depalmitoylases
• VEGA ID
  OTTHUMG00000004495
• Locus Specific Databases
  • Neuronal Ceroid Lipofuscinoses; NCL Mutations
  • Mutations of the Palmitoyl-Protein Thioesterase Gene (PPT CLN1) Gene
  • LRG_690

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products