Recombinant Human Ephrin-B1/EFNB1 (C-6His)

  • Catalog number
    CC54-1000
  • Price
    Please ask
  • Size
    1 mg
  • Description
    Recombinant Human Ephrin-B1 is produced by our Mammalian expression system and the target gene encoding Leu28-Gly232 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human Cells
  • Peptide sequence
    LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGVDHHHHHH
  • Estimated molecular weight
    23,4 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    P98172
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    BBS9, SNAR-B1, PCDHGB1, STON1, MS4A1, SH3GL2, VCX, NABP2, EFNB1
  • Short name
    Recombinant Ephrin-B1/EFNB1 (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human Ephrin-B1/EFNB1(C-6His)
  • Alternative technique
    rec
  • Alternative to gene target
    ephrin-B1, CFND and CFNS and EFB1 and EFL3 and Elk-L and EPLG2 and LERK2, EFNB1 and IDBG-74050 and ENSG00000090776 and 1947, ephrin receptor binding, nuclei, Efnb1 and IDBG-161815 and ENSMUSG00000031217 and 13641, EFNB1 and IDBG-636377 and ENSBTAG00000015801 and 534413
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    small NF90 (ILF3) associated RNA B1
  • Synonyms gene name
    • small ILF3/NF90-associated RNA B1
  • GenBank acession
  • Locus
  • Discovery year
    2008-07-03
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Small NF90 (ILF3) associated RNAs
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    membrane spanning 4-domains A1
  • Synonyms gene
  • Synonyms gene name
    • membrane-spanning 4-domains, subfamily A, member 1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1989-05-23
  • Entrez gene record
    931
  • Pubmed identfication
  • Classification
    • Membrane spanning 4-domains
    • CD molecules
  • VEGA ID
  • Locus Specific Databases
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee