Recombinant Human Ephrin-A4/EFNA4 (C-6His)

  • Catalog number
    C466-500
  • Price
    Please ask
  • Size
    500 ug
  • Description
    Recombinant Human Ephrin-A4 is produced by our Mammalian expression system and the target gene encoding Leu26-Gly171 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGVDHHHHHH
  • Estimated molecular weight
    17,42 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P52798
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    PLP2, PCDHGA4, SNAR-A4, LINC00853, ATP6V0A4, SGCG, EFNA4
  • Short name
    Recombinant Ephrin-A4/EFNA4 (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Recombinant Human EFNA4(C-6His)
  • Alternative technique
    rec
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    small NF90 (ILF3) associated RNA A4
  • Synonyms gene name
    • small nuclear ILF3/NF90-associated RNA A4
    • small ILF3/NF90-associated RNA A4
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-06-20
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Small NF90 (ILF3) associated RNAs
Gene info
  • Identity
  • Gene
  • Long gene name
    long intergenic non-protein coding RNA 853
  • Synonyms gene
  • Synonyms gene name
    • PDZK1IP1 antisense RNA 1 (non-protein coding)
    • PDZK1IP1 antisense RNA 1 (tail to tail)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2012-02-02
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Long intergenic non-protein coding RNAs
  • VEGA ID
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee