Recombinant Human dUTP Pyrophosphatase/dUTPase

• Catalog number
  CF33-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Human dUTP Pyrophosphatase is produced by our E.coli expression system and the target gene encoding Met1-Asn164 is expressed.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
• Estimated molecular weight
  17,7 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry Ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  P33316-2
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  dUTP   Pyrophosphatase/dUTPase  
• Gene symbol
  DUT
• Short name
  Recombinant dUTP Pyrophosphatase/dUTPase
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human dUTP Pyrophosphatase/dUTPase
• Alternative technique
  rec

Gene info

• Identity
  HGNC:3078
• Gene
  DUT
• Long gene name
  deoxyuridine triphosphatase
• Synonyms gene name
  • dUTP pyrophosphatase
• Synonyms
  • dUTPase
• Synonyms name
  • dUTP diphosphatase
• GenBank acession
  • M89913
• Locus
  15q21.1
• Discovery year
  1995-09-28
• Entrez gene record
  1854
• Pubmed identfication
  • 1325640
  • 9070952
• VEGA ID
  OTTHUMG00000172155

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products