Recombinant Human CEACAM21 (C-6His)

• Catalog number
  CC88-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Human CEACAM21 is produced by our Mammalian expression system and the target gene encoding Trp35-Gly240 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  WLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRVYESVAQPSIQASSTTVTEKGSVVLTCHTNNTGTSFQWIFNNQRLQVTKRMKLSWFNHVLTIDPIRQEDAGEYQCEVSNPVSSNRSDPLKLTVKSDDNTLGVDHHHHHH
• Estimated molecular weight
  24,2 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl, pH 7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q3KPI0
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  CEACAM21   C-6His  
• Gene symbol
  CEACAM21
• Short name
  Recombinant CEACAM21 (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human CEACAM21(C-6His)
• Alternative technique
  rec
• Alternative to gene target
  carcinoembryonic antigen-related cell adhesion molecule 21, CEACAM21 and IDBG-53114 and ENSG00000007129 and 90273, protein binding, Plasma membranes

Gene info

• Identity
  HGNC:28834
• Gene
  CEACAM21
• Long gene name
  CEA cell adhesion molecule 21
• Synonyms gene name
  • carcinoembryonic antigen-related cell adhesion molecule 21
  • carcinoembryonic antigen related cell adhesion molecule 21
• Synonyms
  • R29124_1
  • FLJ13540
• GenBank acession
  • AK023602
• Locus
  19q13.2
• Discovery year
  2005-07-25
• Entrez gene record
  90273
• Pubmed identfication
  • 12477932
• RefSeq identity
  • NM_033543
• Classification
  • V-set domain containing
  • CEA cell adhesion molecule family
• VEGA ID
  OTTHUMG00000151062

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products