Recombinant Human CD99 Antigen-Like Protein 2/CD99L2 (C-Fc)

• Catalog number
  CI75-50
• Price
  Please ask
• Size
  50 ug

• Description
  Recombinant Human CD99 Antigen-like protein 2 is produced by our Mammalian expression system and the target gene encoding Asp26-Ala188 is expressed with a Fc tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  DFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Estimated molecular weight
  44,5 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q8TCZ2
• Other related products
• Additional description
  Antigens are peptides or recombinant or native dependent on the production method.
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  CD99   Like   Protein   2/CD99L2   C-Fc  
• Gene symbol
  CD99L2, CD99
• Short name
  Recombinant CD99 Antigen-Like Protein 2/CD99L2 (C-Fc)
• Technique
  Recombinant, antigen, FC, antigenes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human CD99 antigen-like protein 2/CD99L2(C-Fc)
• Alternative technique
  rec, antigenes
• Alternative to gene target
  CD99 molecule, HBA71 and MIC2 and MIC2X and MIC2Y and MSK5X, CD99 and IDBG-40790 and ENSG00000002586 and 4267, Plasma membranes, CD99 and IDBG-639094 and ENSBTAG00000008114 and

Gene info

• Identity
  HGNC:18237
• Gene
  CD99L2
• Long gene name
  CD99 molecule like 2
• Synonyms gene
  • MIC2L1
• Synonyms gene name
  • MIC2 like 1
  • CD99 antigen-like 2
  • CD99 molecule-like 2
• Synonyms
  • CD99B
• GenBank acession
  • BC030536
• Locus
  Xq28
• Discovery year
  2002-02-28
• Entrez gene record
  83692
• RefSeq identity
  • NM_031462
• VEGA ID
  OTTHUMG00000024247
• Locus Specific Databases
  • Global Variome shared LOVD

Gene info

• Identity
  HGNC:7082
• Gene
  CD99
• Long gene name
  CD99 molecule (Xg blood group)
• Synonyms gene
  • MIC2
• Synonyms gene name
  • antigen identified by monoclonal antibodies 12E7, F21 and O13
  • CD99 antigen
  • CD99 molecule
• GenBank acession
  • M16279
• Locus
  Xp22.32 and Yp11.3
• Discovery year
  2001-06-22
• Entrez gene record
  4267
• Pubmed identfication
  • 22356523
• RefSeq identity
  • NM_001122898
• Classification
  • Pseudoautosomal region 1
  • Blood group antigens
  • CD molecules
• VEGA ID
  OTTHUMG00000021073
• Locus Specific Databases
  • Global Variome shared LOVD
  • LRG_1023

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products