Recombinant Human CD8 ß Chain/CD8B (C-6His)

• Catalog number
  C581-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Human CD8B is produced by our Mammalian expression system and the target gene encoding Leu22-Pro170 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPVDHHHHHH
• Estimated molecular weight
  17,8 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  P10966
• Other related products
• Additional description
  Cytotoxic T cells cluster differentiators for flow cytometry. This transmembrane glycoprotein is detected by monoclonals and has a lot of clones available with different affinity.
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  CD8   Chain/CD8B   C-6His  
• Gene symbol
  CD8B, CD8A
• Short name
  Recombinant CD8 ß Chain/CD8B (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Humans
• Alternative name
  Human CD8B(C-6His)
• Alternative technique
  rec
• Alternative to gene target
  CD8b molecule, CD8B and IDBG-60041 and ENSG00000172116 and 100996919,926, MHC class I protein binding, Extracellular, Cd8b1 and IDBG-155547 and ENSMUSG00000053044 and 12526, CD8B and IDBG-634906 and ENSBTAG00000008956 and 508633

Gene info

• Identity
  HGNC:1707
• Gene
  CD8B
• Long gene name
  CD8b molecule
• Synonyms gene
  • CD8B1
• Synonyms gene name
  • CD8 antigen, beta polypeptide 1 (p37)
• Locus
  2p11.2
• Discovery year
  1989-04-13
• Entrez gene record
  926
• Pubmed identfication
  • 1541829
• RefSeq identity
  • NM_172099
• Classification
  • CD molecules
  • V-set domain containing
• VEGA ID
  OTTHUMG00000130264

Gene info

• Identity
  HGNC:1706
• Gene
  CD8A
• Long gene name
  CD8a molecule
• Synonyms gene
  • CD8
• Synonyms gene name
  • CD8 antigen, alpha polypeptide (p32)
  • T-cell surface glycoprotein CD8 alpha chain
• Locus
  2p11.2
• Discovery year
  1986-01-01
• Entrez gene record
  925
• Pubmed identfication
  • 1541829
• RefSeq identity
  • NM_001768
• Classification
  • V-set domain containing
  • CD molecules
• VEGA ID
  OTTHUMG00000130265
• Locus Specific Databases
  • CD8Abase: Mutation registry for CD8 deficiency
  • LRG_44

Product images

Similar products