Recombinant Human CD3 e/CD3E (C-6His)

• Catalog number
  C578-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Human CD3 epsilon is produced by our Mammalian expression system and the target gene encoding Asp23-Asp126 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVDHHHHHH
• Estimated molecular weight
  12,79 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  P07766
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  CD3   e/CD3E   C-6His  
• Gene symbol
  CD3E
• Short name
  Recombinant CD3 e/CD3E (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human CD3 epsilon/CD3E(C-6His)
• Alternative technique
  rec
• Alternative to gene target
  CD3e molecule, epsilon (CD3-TCR complex), IMD18 and T3E and TCRE, CD3E and IDBG-73617 and ENSG00000198851 and 916, protein heterodimerization activity, Cell surfaces, Cd3e and IDBG-159085 and ENSMUSG00000032093 and 12501, CD3E and IDBG-631260 and ENSBTAG00000015710 and 281054

Gene info

• Identity
  HGNC:1674
• Gene
  CD3E
• Long gene name
  CD3e molecule
• Synonyms gene name
  • CD3e antigen, epsilon polypeptide (TiT3 complex)
  • CD3e molecule, epsilon (CD3-TCR complex)
• GenBank acession
  • X03884
• Locus
  11q23.3
• Discovery year
  1986-01-01
• Entrez gene record
  916
• RefSeq identity
  • NM_000733
• Classification
  • CD molecules
• VEGA ID
  OTTHUMG00000166968
• Locus Specific Databases
  • CD3Ebase: Mutation registry for autosomal recessive CD3epsilon immunodeficiency
  • LRG_38

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products