Recombinant Human cAMP-dependent Protein Kinase Inhibitor ß/PKI-ß (N-6His)

• Catalog number
  C247-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Human PKI-beta is produced by our E.coli expression system and the target gene encoding Met1-Lys78 is expressed with a 6His tag at the N-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MGSSHHHHHHSSGLVPRGSHMRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK
• Estimated molecular weight
  10,6 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, 20% Glycerol, pH 8.0.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q9C010
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Additional description
  Tissue, pathway, proteinase, peptidase, protease ,acrosin, lipoprotein, activator, caspase, trypsin, papain, esterase inhibitors are proteins or receptor ligands or receptor antagonists that bind to an enzyme receptor and decreases its activity. Since blocking an enzyme's activity can kill a pathogen or correct a metabolic imbalance, many drugs are enzyme inhibitors. Not all receptor antagonist that bind to enzymes are inhibitors; enzyme activator ligands or agonists bind to enzymes and increase their enzymatic activity, while enzyme substrates bind and are converted to products in the normal catalytic cycle of the enzyme.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  cAMP-dependent   Protein   Kinase   Inhibitor   ß/PKI-ß   N-6His  
• Short name
  Recombinant cAMP-dependent Protein Kinase Inhibitor ß/PKI-ß (N-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Humans
• Alternative name
  Human PKI-beta/PKIB(N-6His)
• Alternative technique
  rec
• Alternative to gene target
  cathelicidin antimicrobial peptide, CAP-18 and CAP18 and CRAMP and FALL-39 and FALL39 and LL37, CAMP and IDBG-32341 and ENSG00000164047 and 820, protein binding, Extracellular, Camp and IDBG-201591 and ENSMUSG00000038357 and 12796

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products