Recombinant Human C1QBP/HABP1 (C-6His)

• Catalog number
  CF70-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Human Hyaluronic Acid-binding Protein is produced by our E.coli expression system and the target gene encoding Leu74-Gln282 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQLEHHHHHH
• Estimated molecular weight
  24,9 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 20mM Tris, 20% Glycerol, 1mM DTT, pH 7.5.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q07021
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  C1QBP/HABP1   C-6His  
• Gene symbol
  C1QBP
• Short name
  Recombinant C1QBP/HABP1 (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human HABP1/C1qBP(C-6His)
• Alternative technique
  rec
• Alternative to gene target
  complement component 1, q subcomponent binding protein, gC1Q-R and GC1QBP and gC1qR and HABP1 and p32 and SF2p32, C1QBP and IDBG-21497 and ENSG00000108561 and 708, mitochondrial ribosome binding, nuclei, C1qbp and IDBG-195770 and ENSMUSG00000018446 and 12261, C1QBP and IDBG-634029 and ENSBTAG00000012739 and 518321

Gene info

• Identity
  HGNC:1243
• Gene
  C1QBP
• Long gene name
  complement C1q binding protein
• Synonyms gene
  • HABP1
• Synonyms gene name
  • complement component 1, q subcomponent binding protein
• Synonyms
  • gC1Q-R
  • gC1qR
  • p32
  • SF2p32
• Synonyms name
  • C1q globular domain-binding protein
  • hyaluronan-binding protein 1
  • splicing factor SF2-associated protein
• GenBank acession
  • X75913
• Locus
  17p13.2
• Discovery year
  1995-12-11
• Entrez gene record
  708
• Pubmed identfication
  • 8567680
  • 8195709
• RefSeq identity
  • NM_001212
• VEGA ID
  OTTHUMG00000177875

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products