Recombinant Human BMP Receptor II/BMPR2/PPH1 (C-6His)

  • Catalog number
    C303-1000
  • Price
    Please ask
  • Size
    1 mg
  • Description
    Recombinant Human BMP Receptor II is produced by our Mammalian expression system and the target gene encoding Ser27-Ile151 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human Cells
  • Peptide sequence
    SQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDETIVDHHHHHH
  • Estimated molecular weight
    15,05 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    Q13873
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Additional description
    The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    BMPR2, GDF11, GDF10, GDF2, BMP1
  • Short name
    Recombinant BMP Receptor II/BMPR2/PPH1 (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human BMP Receptor II/BMPR2/PPH1(C-6His)
  • Alternative technique
    rec
  • Alternative to gene target
    bone morphogenetic protein receptor, type II (serine/threonine kinase), BMPR-II and BMPR3 and BMR2 and BRK-3 and POVD1 and PPH1 and T-ALK, BMPR2 and IDBG-78880 and ENSG00000204217 and 659, activin receptor activity, Extracellular, Bmpr2 and IDBG-158574 and ENSMUSG00000067336 and 12168, BT.25715 and IDBG-643309 and ENSBTAG00000006420 and 407127
Gene info
  • Identity
  • Gene
  • Long gene name
    bone morphogenetic protein receptor type 2
  • Synonyms gene
  • Synonyms gene name
    • primary pulmonary hypertension 1
    • bone morphogenetic protein receptor, type II (serine/threonine kinase)
    • bone morphogenetic protein receptor type II
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1997-03-19
  • Entrez gene record
    659
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Type 2 receptor serine/threonine kinases
  • VEGA ID
  • Locus Specific Databases
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee