Recombinant Human Angiopoietin-related Protein 7/ANGPTL7 (C-10His)

• Catalog number
  CU24-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Human Angiopoietin-related Protein 7 is produced by our Mammalian expression system and the target gene encoding Gln27-Pro346 is expressed with a 10His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKPHHHHHHHHHH
• Estimated molecular weight
  38,4 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  O43827
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Angiopoietin-related   Protein   7/ANGPTL7   C-10His  
• Gene symbol
  ANGPTL7
• Short name
  Recombinant Angiopoietin- Protein 7/ANGPTL7 (C-10His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Recombinant Human ANGPTL7 (C-10His)
• Alternative technique
  rec

Gene info

• Identity
  HGNC:24078
• Gene
  ANGPTL7
• Long gene name
  angiopoietin like 7
• Synonyms gene name
  • angiopoietin-like 7
• Synonyms
  • CDT6
  • AngX
• GenBank acession
  • Y16132
• Locus
  1p36.22
• Discovery year
  2005-01-07
• Entrez gene record
  10218
• Pubmed identfication
  • 9727400
  • 11682471
• RefSeq identity
  • NM_021146
• Classification
  • Fibrinogen C domain containing
  • Receptor ligands
  • Angiopoietin like family
• VEGA ID
  OTTHUMG00000002002

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products