Recombinant Mouse Adiponectin/Acrp30/AdipoQ (C-6His, Human Cells)
-
Catalog number
CI89-50
-
Price
Please ask
-
Size
50 ug
-
-
Description
Recombinant Mouse Adiponectin is produced by our Mammalian expression system and the target gene encoding Glu18-Asn247 is expressed with a 6His tag at the C-terminus.
-
Species reactivity
Mouse
-
Origin
Human cells
-
Peptide sequence
EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTNHHHHHH
-
Estimated molecular weight
27,6 kDa
-
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
-
Shipping condition
Ambient/Room Temperature
-
Package form
Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
-
Storage conditions
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
-
Reconstitution conditions
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
-
UniProt number
Q60994
-
-
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
Test
Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
-
Latin name
Mus musculus
-
Source
Recombinants or rec. proteins
-
Group
recombinants
-
Gene target
-
Short name
Recombinant Mouse Adiponectin/Acrp30/AdipoQ (C-6His, Cells)
-
Technique
Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
-
Host
mouse
-
Species
Human, Humans, Mouses
-
Alternative name
Mouse Adiponectin/Acrp30(C-6His)
-
Alternative technique
rec, murine
-
Alternative to gene target
adiponectin, C1Q and collagen domain containing, ACDC and ACRP30 and ADIPQTL1 and ADPN and APM-1 and APM1 and GBP28, ADIPOQ and IDBG-69167 and ENSG00000181092 and 9370, protein homodimerization activity, Extracellular, Adipoq and IDBG-149533 and ENSMUSG00000022878 and 11450, ADIPOQ and IDBG-634641 and ENSBTAG00000019813 and 282865
-
Tissue
cells
-
MeSH Data
-
Name
-
Concept
Scope note:
The initial culturing of cells derived directly from fresh TISSUES.
-
Tree numbers
- E01.370.225.500.223.500
- E05.200.500.265.500
- E05.242.223.500
- E05.481.500.249.500
-
Qualifiers
ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products