Recombinant Human Adaptin Ear-Binding Coat-Associated Protein 2/NECAP2 (N, C-6His)

• Catalog number
  CG68-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Human NECAP2 is produced by our E.coli expression system and the target gene encoding Met1-Phe263 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MGSSHHHHHHSSGLVPRGSHMEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQFLEHHHHHH
• Estimated molecular weight
  31,5 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry Ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q9NVZ3
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Adaptin   Ear-Binding   Coat-Associated   Protein   2/NECAP2   C-6His  
• Gene symbol
  NECAP2
• Short name
  Recombinant Adaptin Ear-Binding Coat-Associated Protein 2/NECAP2 (N, C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human NECAP2(N, C-6His)
• Alternative technique
  rec
• Alternative to gene target
  NECAP endocytosis associated 2, NECAP2 and IDBG-91496 and ENSG00000157191 and 55707, Plasma membranes, Necap2 and IDBG-201832 and ENSMUSG00000028923 and 66147, NECAP2 and IDBG-645844 and ENSBTAG00000013282 and 509439

Gene info

• Identity
  HGNC:25528
• Gene
  NECAP2
• Long gene name
  NECAP endocytosis associated 2
• Synonyms
  • FLJ10420
• Synonyms name
  • adaptin-ear-binding coat-associated protein 2
• GenBank acession
  • AK021938
• Locus
  1p36.13
• Discovery year
  2005-08-15
• Entrez gene record
  55707
• Pubmed identfication
  • 14555962
  • 15494011
• RefSeq identity
  • NM_018090
• VEGA ID
  OTTHUMG00000002313

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products