Recombinant Human a-Crystallin A Chain/CRYAA (C-6His)

• Catalog number
  CF01-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Human alpha-Crystallin A Chain is produced by our E.coli expression system and the target gene encoding Met1-Ser173 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSSLEHHHHHH
• Estimated molecular weight
  20,9 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS, 2mM EDTA, pH 8.0.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  P02489
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  a-Crystallin   Chain/CRYAA   C-6His  
• Gene symbol
  CRYAA
• Short name
  Recombinant a-Crystallin A Chain/CRYAA (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human alpha-Crystallin A Chain/CRYAA(C-6His)
• Alternative technique
  rec
• Alternative to gene target
  crystallin, alpha A, CRYAA and IDBG-4699 and ENSG00000160202 and 102724652,1409, unfolded protein binding, nuclei, Cryaa and IDBG-164758 and ENSMUSG00000024041 and 12954, CRYAA and IDBG-639603 and ENSBTAG00000003134 and 281718

Gene info

• Identity
  HGNC:2388
• Gene
  CRYAA
• Long gene name
  crystallin alpha A
• Synonyms gene
  • CRYA1
• Synonyms gene name
  • crystallin, alpha A
• Synonyms
  • HSPB4
• Locus
  21q22.3
• Discovery year
  1986-01-01
• Entrez gene record
  1409
• Classification
  • Small heat shock proteins
• VEGA ID
  OTTHUMG00000086842
• Locus Specific Databases
  • Global Variome shared LOVD

MeSH Data

• Name
  Crystallization
• Concept
  Scope note: The formation of crystalline substances from solutions or melts. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
• Tree numbers
  • E05.196.300
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products