Recombinant Bovine

24x Recombinant Bovine found in bioma

  • Verified reactivity
    Bos taurus (Bovine)
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Bovine, Bos Taurus genes are available form the Bovine Genome database.
  • Alternative technique
    rec

RPC20253 | Recombinant Bovine coronavirus Hemagglutinin-esterase(HE)size: 200 μg | 852.95 USD

Ajax processing

RPC20253 | Recombinant Bovine coronavirus Hemagglutinin-esterase(HE)size: 500 μg | 1321.09 USD

Ajax processing

RPC20253 | Recombinant Bovine coronavirus Hemagglutinin-esterase(HE)size: 10 μg | 202.21 USD

Ajax processing

RPC20253 | Recombinant Bovine coronavirus Hemagglutinin-esterase(HE)size: 1 mg | 1959.57 USD

Ajax processing

RPC20253 | Recombinant Bovine coronavirus Hemagglutinin-esterase(HE)size: 50 μg | 383.58 USD

Ajax processing

RPC20253 | Recombinant Bovine coronavirus Hemagglutinin-esterase(HE)size: 100 μg | 567.41 USD

Ajax processing

RPC20536 | Recombinant Bovine Interferon omega-1(IFNW1)size: 200 μg | 564.96 USD

Ajax processing

RPC20536 | Recombinant Bovine Interferon omega-1(IFNW1)size: 100 μg | 421.57 USD

Ajax processing

RPC20536 | Recombinant Bovine Interferon omega-1(IFNW1)size: 10 μg | 202.21 USD

Ajax processing

RPC20536 | Recombinant Bovine Interferon omega-1(IFNW1)size: 500 μg | 1018.39 USD

Ajax processing

RPC20536 | Recombinant Bovine Interferon omega-1(IFNW1)size: 50 μg | 351.72 USD

Ajax processing

RPC20536 | Recombinant Bovine Interferon omega-1(IFNW1)size: 1 mg | 1417.9 USD

Ajax processing

RPC20072 | Recombinant Bovine Resistin(RETN)size: 50 μg | 383.58 USD

Ajax processing

RPC20072 | Recombinant Bovine Resistin(RETN)size: 500 μg | 1321.09 USD

  • Catalog number
    RPC20072
  • Supplier
  • Price
    1321.09 USD
  • Size
    500 μg
  • Protein number
    Q762I5
  • Gene number
    RETN
  • Other name
    no alternative name
  • Protein origin
    E.coli
  • Protein region
    19-109aa
  • Protein sequence
    QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRLHIQ
  • Information about sequence
    Full Length
  • Expected molecular weight
    13.7kDa
  • Protein purity
    ≥ 90%
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Resistin(RETN)
  • Alternative name
    recombinant Bovine Resistin(resistin)
  • Alternative to gene target
    resistin, RETN and IDBG-23228 and ENSG00000104918 and 56729, this GO :0005179 and hormone activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0007568 and aging and biological process this GO :0008150 and biological process and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0010714 and positive regulation of collagen metabolic process and biological process this GO :0014911 and positive regulation of smooth muscle cell migration and biological process this GO :0032868 and response to insulin and biological process this GO :0045444 and fat cell differentiation and biological process this GO :0048661 and positive regulation of smooth muscle cell proliferation and biological process this GO :0050806 and positive regulation of synaptic transmission and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :2000252 and negative regulation of feeding behavior and biological process this GO :2000872 and positive regulation of progesterone secretion and biological process, hormone activity, this GO :0005179: hormone activity, this GO :0005179: hormone activity, nuclei, Retn and IDBG-130350 and ENSMUSG00000012705 and 57264, RETN and IDBG-643684 and ENSBTAG00000004716 and 369020
1. Gene info
MeSH Data
  • Name
  • Concept
    Scope note:The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    classification, economics, history, instrumentation, methods, standards, trends, utilization, veterinary, statistics & numerical data, ethics
Additional information

RPC20072 | Recombinant Bovine Resistin(RETN)size: 1 mg | 1959.57 USD

Ajax processing

RPC20072 | Recombinant Bovine Resistin(RETN)size: 100 μg | 567.41 USD

Ajax processing

RPC20072 | Recombinant Bovine Resistin(RETN)size: 10 μg | 202.21 USD

Ajax processing

RPC20072 | Recombinant Bovine Resistin(RETN)size: 200 μg | 852.95 USD

Ajax processing

RPC20094 | Recombinant Bovine Transforming growth factor beta-1(TGFB1),partialsize: 100 μg | 567.41 USD

Ajax processing

RPC20094 | Recombinant Bovine Transforming growth factor beta-1(TGFB1),partialsize: 200 μg | 852.95 USD

Ajax processing

RPC20094 | Recombinant Bovine Transforming growth factor beta-1(TGFB1),partialsize: 500 μg | 1321.09 USD

Ajax processing

RPC20094 | Recombinant Bovine Transforming growth factor beta-1(TGFB1),partialsize: 50 μg | 383.58 USD

Ajax processing

RPC20094 | Recombinant Bovine Transforming growth factor beta-1(TGFB1),partialsize: 1 mg | 1959.57 USD

Ajax processing

RPC20094 | Recombinant Bovine Transforming growth factor beta-1(TGFB1),partialsize: 10 μg | 202.21 USD

Ajax processing
Simillar products
Supplier:acr
Price:577.21USD
Supplier:MBS Recombinant
Price:2 289.23USD
Supplier:abbex
Price:1 105.40USD
Supplier:SFC
Price:0.00USD
Supplier:Trevigen
Price:200.98USD
Supplier:fitzgerald
Price:627.46USD
Supplier:Molekula
Price:332.11USD
Supplier:aviva
Price:383.58USD
Supplier:abbex
Price:727.95USD
Supplier:MBS Recombinant
Price:1 849.28USD
Supplier:acr
Price:665.45USD
Supplier:aviva
Price:383.58USD
Supplier:aviva
Price:519.61USD
Supplier:trca
Price:132.35USD
Supplier:MBS Recombinant
Price:1 625.01USD
Supplier:fitzgerald
Price:582.11USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Recombinant Bovine - Gentaur.com
Contact
Chat with gentaur.com employee