Recombinant Aspergillus niger Aspergillopepsin 2

Recombinant Aspergillus niger Aspergillopepsin 2 is available 6 times from Bioma labs

  • Use before
    1 year
  • Other name
    Acid protease A; Aspergillopepsin II; Proctase A
  • Information about sequence
    Full Length
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Protein origin
    E.coli
  • Estimated production time
    7-11 business days
  • Shipping requirements
    Blue ice
  • Verified reactivity
    Aspergillus niger
  • Gene number
    Please refer to GenBank
  • Protein purity
    ≥ 90%
  • Gene name
    Please refer to GenBank
  • Protein number
    P24665 
  • Protein region
    60-98aa
  • Protein sequence
    EEYSSNWAGAVLIGDGYTKVTGEFTVPSVSAGSSGSSGY
  • Notes
    For research use only. Not for diagnostic procedures.
  • Gene target
  • Short name
    Recombinant Aspergillus niger Aspergillopepsin-2
  • Technique
    Recombinant
  • Alternative name
    recombinant Aspergillus niger Aspergillopepsin-2
  • Alternative technique
    rec

RPC20396 | Recombinant Aspergillus niger Aspergillopepsin-2size: 500 μg | 1325.83 USD

Ajax processing

RPC20396 | Recombinant Aspergillus niger Aspergillopepsin-2size: 100 μg | 569.44 USD

Ajax processing

RPC20396 | Recombinant Aspergillus niger Aspergillopepsin-2size: 200 μg | 856.01 USD

Ajax processing

RPC20396 | Recombinant Aspergillus niger Aspergillopepsin-2size: 10 μg | 202.93 USD

Ajax processing

RPC20396 | Recombinant Aspergillus niger Aspergillopepsin-2size: 50 μg | 384.96 USD

Ajax processing

RPC20396 | Recombinant Aspergillus niger Aspergillopepsin-2size: 1 mg | 1966.61 USD

  • Catalog number
    RPC20396
  • Supplier
  • Price
    1966.61 USD
  • Size
    1 mg
  • Expected molecular weight
    20.4kDa
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
MeSH Data
  • Name
  • Concept
    Scope note:The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    classification, economics, history, instrumentation, methods, standards, trends, utilization, veterinary, statistics & numerical data, ethics
Additional information
Simillar products
Supplier:ABM microrna
Price:5 292.26USD
Supplier:ABM CrispR
Price:7 159.25USD
Supplier:abm Adinovirus
Price:530.09USD
Supplier:BlueGen ELISAs
Price:744.09USD
Supplier:aviva
Price:521.48USD
Supplier:abbex
Price:730.56USD
Supplier:aviva
Price:263.20USD
Supplier:genways
Price:569.44USD
Supplier:Zyagen
Price:608.80USD
Supplier:nordc
Price:259.51USD
Supplier:MBS Recombinant
Price:1 740.31USD
Supplier:abm Adinovirus
Price:1 060.17USD
Supplier:MBS Recombinant
Price:2 058.85USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Recombinant Aspergillus niger Aspergillopepsin 2|gentaur.com
Contact
Chat with gentaur.com employee