Recombinant Aequorea victoria Green fluorescent protein GFP

Recombinant Aequorea victoria Green fluorescent protein GFP is available 6 times from Bioma labs

  • Other name
    no alternative name
  • Protein origin
    E.coli
  • Estimated production time
    7-11 business days
  • Gene number
    GFP
  • Gene name
    GFP
  • Protein number
    P42212 
  • Protein sequence
    MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
  • Notes
    For research use only. Not for diagnostic procedures.
  • Use before
    1 year
  • Information about sequence
    Full Length
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Shipping requirements
    Blue ice
  • Verified reactivity
    Aequorea victoria (Jellyfish)
  • Protein purity
    ≥ 90%
  • Protein region
    1-238aa
  • Gene target
  • Short name
    Recombinant Aequorea victoria protein(GFP)
  • Technique
    Recombinant
  • Label
    green
  • Alternative name
    recombinant Aequorea victoria Green fluorescent protein(Green Fluorescent)
  • Alternative technique
    rec

RPC20120 | Recombinant Aequorea victoria Green fluorescent protein(GFP)size: 1 mg | 1966.61 USD

Ajax processing

RPC20120 | Recombinant Aequorea victoria Green fluorescent protein(GFP)size: 100 μg | 569.44 USD

Ajax processing

RPC20120 | Recombinant Aequorea victoria Green fluorescent protein(GFP)size: 500 μg | 1325.83 USD

  • Catalog number
    RPC20120
  • Supplier
  • Price
    1325.83 USD
  • Size
    500 μg
  • Expected molecular weight
    42.87kDa
  • Description
    Fluorescent microspheres, beads and particles applications including blood flow determination, tracing, fluorimetry, in vivo imaging and calibration of imaging and flow cytometry instruments. Because our fluorescent dyes are incorporated in the bead and not just on the surface, they are relatively immune to photo bleaching and other environmental factors. Spheres are in difference sizes and fluorescences, high intensity, FITC, GFP, red, green, yellow, light yellow, sky blue, blue, orange, deep-red, Nile-red, purple, mcherry. The diameter of the spheres is usually higher than 50nm and in the micrometer um range.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
MeSH Data
  • Name
  • Concept
    Scope note:An in vitro allergen radioimmunoassay in which allergens are coupled to an immunosorbent. The coupled allergens bind the IgE in the sera of patients which in turn binds radioisotope-labeled anti-IMMUNOGLOBULIN E antibodies.
  • Tree numbers
    • E01.370.225.812.735.830
    • E05.200.812.735.830
    • E05.478.566.380.810
    • E05.478.566.639.810
    • E05.478.594.760.830
    • E05.601.470.380.810
    • E05.601.470.639.810
  • Qualifiers
    adverse effects, classification, economics, history, instrumentation, methods, mortality, nursing, psychology, standards, trends, utilization, veterinary, statistics & numerical data, contraindications, ethics
Additional information

RPC20120 | Recombinant Aequorea victoria Green fluorescent protein(GFP)size: 10 μg | 202.93 USD

Ajax processing

RPC20120 | Recombinant Aequorea victoria Green fluorescent protein(GFP)size: 200 μg | 856.01 USD

Ajax processing

RPC20120 | Recombinant Aequorea victoria Green fluorescent protein(GFP)size: 50 μg | 384.96 USD

Ajax processing
Simillar products
Supplier:abbex
Price:121.76USD
Supplier:abbex
Price:499.34USD
Supplier:SFC
Price:0.00USD
Supplier:abm Adinovirus
Price:530.09USD
Supplier:genways bulk
Price:0.00USD
Supplier:trca
Price:141.44USD
Supplier:MBS Recombinant
Price:2 215.05USD
Supplier:MBS Polyclonals
Price:448.91USD
Supplier:abm Adinovirus
Price:530.09USD
Supplier:genways bulk
Price:0.00USD
Supplier:MBS Recombinant
Price:1 705.87USD
Supplier:abbex
Price:982.69USD
Supplier:SFC
Price:0.00USD
Supplier:trca
Price:258.28USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Recombinant Aequorea victoria Green fluorescent |gentaur.com
Contact
Chat with gentaur.com employee