Rasa1 Blocking Peptide

• Catalog number
  33R-8652
• Price
  Please ask
• Size
  100 µg

• Category
  Proteins
• Antibody Subtype
  Blocking Peptides
• Area of research
  Signal Transduction
• Residues
  SNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRT
• Type of protein
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• URL
• More info
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  Rasa1  
• Gene symbol
  RASA1
• Short name
  Rasa1 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  A synthetic peptide for use as a blocking control in assays to test for specificity of Rasa1 antibody, catalog no. 70R-8527
• Alternative technique
  control, peptides
• Alternative to gene target
  RAS p21 protein activator (GTPase activating protein) 1, CM-AVM and CMAVM and GAP and p120GAP and p120RASGAP and PKWS and RASA and RASGAP, RASA1 and IDBG-32785 and ENSG00000145715 and 5921, GTPase binding, Plasma membranes, Rasa1 and IDBG-170464 and ENSMUSG00000021549 and 218397, BT.102247 and IDBG-646529 and ENSBTAG00000009565 and 282032

Gene info

• Identity
  HGNC:9871
• Gene
  RASA1
• Long gene name
  RAS p21 protein activator 1
• Synonyms gene
  • RASA
• Synonyms gene name
  • RAS p21 protein activator (GTPase activating protein) 1
• Synonyms
  • GAP
  • CM-AVM
  • p120GAP
  • p120RASGAP
  • p120
• Synonyms name
  • capillary malformation-arteriovenous malformation
  • p120 RAS GTPase activating protein
• Locus
  5q14.3
• Discovery year
  1989-06-30
• Entrez gene record
  5921
• Pubmed identfication
  • 15917201
• RefSeq identity
  • NM_002890
• Classification
  • SH2 domain containing
  • C2 and RasGAP domain containing
  • Pleckstrin homology domain containing
• VEGA ID
  OTTHUMG00000162605
• Locus Specific Databases
  • SH2base: Database for pathogenic SH2 domain mutations

Similar products