Rabbit PTGES3 antibody
-
Catalog number70R-2745
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Cycle & Cell Death
-
ImmunogenPTGES3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKM
-
SpecificityNA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PTGES3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPTGES3
-
Short nameRabbit PTGES3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PTGES3 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetprostaglandin E synthase 3 (cytosolic), cPGES and P23 and TEBP, PTGES3 and IDBG-41485 and ENSG00000110958 and 10728, unfolded protein binding, nuclei, Ptges3 and IDBG-196476 and ENSMUSG00000071072 and 100043508,102641464,56351, PTGES3 and IDBG-635887 and ENSBTAG00000017967 and 493638
-
Gene info
-
Identity
-
Gene
-
Long gene nameprostaglandin E synthase 3
-
Synonyms gene name
- prostaglandin E synthase 3 (cytosolic)
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2005-06-28
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data