Rabbit PSMB9 antibody

• Catalog number
  70R-5740
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Protein Modification & Stress Response
• Immunogen
  PSMB9 antibody was raised using the C terminal of PSMB9 corresponding to a region with amino acids RRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
• Specificity
  PSMB9 antibody was raised against the C terminal of PSMB9
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMB9 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  PSMB9  
• Gene symbol
  PSMB9
• Short name
  Rabbit PSMB9 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal PSMB9 antibody raised against the C terminal of PSMB9
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2), beta1i and LMP2 and PSMB6i and RING12, PSMB9 and IDBG-403299 and ENSG00000240065 and 5698, protein binding, nuclei, Psmb9 and IDBG-705306 and ENSMUSG00000096727 and 16912, PSMB9 and IDBG-628867 and ENSBTAG00000008954 and 510593

Gene info

• Identity
  HGNC:9546
• Gene
  PSMB9
• Long gene name
  proteasome 20S subunit beta 9
• Synonyms gene
  • LMP2
• Synonyms gene name
  • proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional protease 2)
  • large multifunctional peptidase 2
  • proteasome (prosome, macropain) subunit, beta type, 9
  • proteasome subunit beta 9
• Synonyms
  • RING12
  • beta1i
  • PSMB6i
• Synonyms name
  • proteasome subunit β1i
• Locus
  6p21.32
• Discovery year
  1991-12-18
• Entrez gene record
  5698
• Pubmed identfication
  • 1922385
  • 1529427
• RefSeq identity
  • NM_002800
• Classification
  • Proteasome
• VEGA ID
  OTTHUMG00000031287

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products