PSMA5 Blocking Peptide

  • Catalog number
    33R-2904
  • Price
    Please ask
  • Size
    100 ug
  • Product Type
    Proteins
  • Product Subtype
    Blocking Peptides
  • Research Area
    Protein Modification & Stress Response
  • Tag Conjugate
    FGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLK
  • Type1
    Synthetic
  • Form Buffer
    Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Storage
    Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
  • Applications
    WB, IHC
  • Shipping Info
    Blue Ice
  • Test
    You can block the antibody by the specific target amino acid sequence of peptide.
  • Properties
    blocking peptide
  • Description
    Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
  • Gene target
    PSMA5  
  • Gene symbol
    PSMA5
  • Short name
    PSMA5 Blocking Peptide
  • Technique
    blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
  • Alternative name
    proteasome (prosome, macropain) subunit, alpha classification, 5 inhibiting short protein sequence
  • Alternative technique
    control, peptides
  • Alternative to gene target
    proteasome (prosome, macropain) subunit, alpha type, 5, PSC5 and ZETA, PSMA5 and IDBG-100819 and ENSG00000143106 and 5686, protein binding, nuclei, PSMA5 and IDBG-635413 and ENSBTAG00000020641 and 510155
Gene info
  • Identity
  • Gene
  • Long gene name
    proteasome 20S subunit alpha 5
  • Synonyms gene name
    • proteasome (prosome, macropain) subunit, alpha type, 5
    • proteasome subunit alpha 5
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1995-05-03
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Proteasome
  • VEGA ID
Similar products
Filters
Contact
Chat with gentaur.com employee