PRKAR1A Blocking Peptide

• Catalog number
  33R-6264
• Price
  Please ask
• Size
  100 µg

• Category
  Proteins
• Antibody Subtype
  Blocking Peptides
• Area of research
  Cell Biology
• Residues
  MNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLS
• Type of protein
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• URL
• More info
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  PRKAR1A  
• Gene symbol
  PRKAR1A
• Short name
  PRKAR1A Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  A synthetic peptide for use as a blocking control in assays to test for specificity of PRKAR1A antibody, catalog no. 70R-9554
• Alternative technique
  control, peptides
• Alternative to gene target
  protein kinase, cAMP-dependent, regulatory, type I, alpha, ACRDYS1 and ADOHR and CAR and CNC and CNC1 and PKR1 and PPNAD1 and PRKAR1 and TSE1, PRKAR1A and IDBG-65907 and ENSG00000108946 and 5573, protein kinase A catalytic subunit binding, Plasma membranes, Prkar1a and IDBG-213854 and ENSMUSG00000020612 and 19084, PRKAR1A and IDBG-643694 and ENSBTAG00000008621 and 615074

Gene info

• Identity
  HGNC:9388
• Gene
  PRKAR1A
• Long gene name
  protein kinase cAMP-dependent type I regulatory subunit alpha
• Synonyms gene
  • PRKAR1
  • TSE1
• Synonyms gene name
  • tissue specific extinguisher 1
  • protein kinase, cAMP-dependent, regulatory, type I, alpha
  • protein kinase, cAMP-dependent, regulatory subunit type I alpha
• Synonyms
  • CNC1
• Synonyms name
  • Carney complex type 1
• Locus
  17q24.2
• Discovery year
  1988-05-11
• Entrez gene record
  5573
• Pubmed identfication
  • 3479018
  • 10973256
• VEGA ID
  OTTHUMG00000180128
• Locus Specific Databases
  • LRG_514

Similar products