PPP1R8 antibody

PPP1R8 antibody is available 5 times from Fitzgerald labs

70R-4732 | PPP1R8 antibodysize: 50 µg | 554.18 USD

Ajax processing

70R-1468 | PPP1R8 antibodysize: 100 µg | 453.85 USD

  • Catalog number
  • Supplier
  • Price
    453.85 USD
  • Size
    100 µg
  • Area of research
    Signal Transduction
  • Type of Immunogen
    PPP1R8 antibodies were raised using a synthetic peptide corresponding to a region with amino acids THGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGD
  • Cross Reactivity
  • Method of Purification
    Total IgG Protein A purified
  • Concentration
    1 mg/ml
  • Form & Buffer
    Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PPP1R8 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
  • Usage Recommendations
    WB: 1.25 ug/ml
  • Assay Information
    PPP1R8 Blocking Peptide, catalog no. 33R-9105, is also available for use as a blocking control in assays to test for specificity of this PPP1R8 antibody
  • Additional Information
    This is a rabbit polyclonal antibody against PPP1R8, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com
1. Gene info
MeSH Data
  • Name
  • Concept
    Scope note:Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
Additional information

70R-4733 | PPP1R8 antibodysize: 50 µg | 554.18 USD

Ajax processing

70R-1314 | PPP1R8 antibodysize: 100 µg | 453.85 USD

Ajax processing

70R-19477 | PPP1R8 antibodysize: 50 µl | 597.35 USD

Ajax processing
  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Raised in
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
  • Gene target
  • Short name
    PPP1R8 antibody
  • Technique
  • Alternative name
    PPP1R8 (Antibody to)
  • Alternative technique
Simillar products
Supplier:Assay Biotech
+32-(0)1-658-90-45 lieven@gentaur.com
PPP1R8 antibody - Gentaur.com
Chat with gentaur.com employee