Rabbit PPP2R1A antibody

• Catalog number
  70R-2215
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  PPP2R1A antibody was raised using a synthetic peptide corresponding to a region with amino acids NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL
• Specificity
  NA
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP2R1A antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  PPP2R1A  
• Gene symbol
  PPP2R1A
• Short name
  Rabbit PPP2R1A antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal PPP2R1A antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  protein phosphatase 2, regulatory subunit A, alpha, PP2A-Aalpha and PP2AAALPHA and PR65A, PPP2R1A and IDBG-66700 and ENSG00000105568 and 5518, protein heterodimerization activity, nuclei, Ppp2r1a and IDBG-141714 and ENSMUSG00000007564 and 51792, PPP2R1A and IDBG-641451 and ENSBTAG00000019851 and 535321

Gene info

• Identity
  HGNC:9302
• Gene
  PPP2R1A
• Long gene name
  protein phosphatase 2 scaffold subunit Aalpha
• Synonyms gene name
  • protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform
• Synonyms
  • PR65A
  • PP2A-Aalpha
  • PP2AA
• Synonyms name
  • protein phosphatase 2A, regulatory subunit A, alpha isoform
  • protein phosphatase 2, 65kDa regulatory subunit A
  • protein phosphatase 2A structural subunit A, alpha isoform
• Locus
  19q13.41
• Discovery year
  1993-01-25
• Entrez gene record
  5518
• RefSeq identity
  • NM_014225
• Classification
  • STRIPAK complex
  • Protein phosphatase 2 scaffold subunits
  • Armadillo like helical domain containing
  • MicroRNA protein coding host genes
• VEGA ID
  OTTHUMG00000137367

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products