Rabbit POLR3A antibody
-
Catalog number70R-2159
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenPOLR3A antibody was raised using the middle region of POLR3A corresponding to a region with amino acids AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT
-
SpecificityPOLR3A antibody was raised against the middle region of POLR3A
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POLR3A antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPOLR3A
-
Short nameRabbit POLR3A antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal POLR3A antibody raised against the middle region of POLR3A
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetpolymerase (RNA) III (DNA directed) polypeptide A, 155kDa, ADDH and HLD7 and hRPC155 and RPC1 and RPC155, POLR3A and IDBG-79933 and ENSG00000148606 and 11128, ribonucleoside binding, nuclei, Polr3a and IDBG-138475 and ENSMUSG00000025280 and 218832, POLR3A and IDBG-630873 and ENSBTAG00000013259 and 540308
-
Gene info
-
Identity
-
Gene
-
Long gene nameRNA polymerase III subunit A
-
Synonyms gene name
- polymerase (RNA) III (DNA directed) polypeptide A, 155kDa
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2004-09-16
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- RNA polymerase subunits
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data