Dishevelled 2 Antibody
-
Catalog numberA02404-3
-
PricePlease ask
-
Size0,1 mg
-
-
Target antigenDishevelled 2
-
ClonalityPolyclonal antibody
-
ClonePolyclonal antibody
-
Raised inrabbit
-
Type of the antibodyIgG polyclonal antibody
-
Product formfreeze-dried
-
Reacts with specieshuman, mouse, rat
-
AnalysesWB
-
ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human Dishevelled 2 (35-64aa AERITLGDFKSVLQRPAGAKYFFKSMDQDF), identical to the related mouse sequence.
-
Product configurationEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
PurificationImmunogen affinity purified.
-
SolubilizationThe powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtionsKeep the Dishevelled 2 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
TipsThe Dishevelled 2 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
BackgroundSegment polarity protein dishevelled homolog DVL-2 is a protein that in humans is encoded by the DVL2 gene. This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40% amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.
-
Related articles1. Greco TL, Sussman DJ, Camper SA (January 1997). "Dishevelled-2 maps to human chromosome 17 and distal to Wnt3a and vestigial tail (vt) on mouse chromosome 11". Mamm Genome. 7 (6): 475–6. 2. Hocevar, B A; Mou F; Rennolds J L; Morris S M; Cooper J A; Howe P H (June 2003). "Regulation of the Wnt signaling pathway by disabled-2 (Dab2)". EMBO J. England. 22 (12): 3084–94.
-
Gene NameDVL2
-
Protein NameSegment polarity protein dishevelled homolog DVL-2
-
Gene Full Namedishevelled segment polarity protein 2
-
SynonymsDishevelled-2 | Dishevelled2 | DSH homolog 2 | DVL 2 | Dvl2 | O14641
-
Uniprot IDO14641
-
Entrez GeneID1856
-
PropertiesIf you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolDVL2, DAAM2, DACT2
-
Short nameDishevelled 2 Antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameDishevelled 2 (antibody to-)
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene namedishevelled segment polarity protein 2
-
Synonyms gene name
- dishevelled 2 (homologous to Drosophila dsh)
- dishevelled, dsh homolog 2 (Drosophila)
-
GenBank acession
-
Locus
-
Discovery year1996-03-12
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- PDZ domain containing
- Dishevelled segment polarity proteins
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namedishevelled associated activator of morphogenesis 2
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2002-02-06
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Formins
- Armadillo like helical domain containing
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namedishevelled binding antagonist of beta catenin 2
-
Synonyms gene
-
Synonyms gene name
- chromosome 6 open reading frame 116
- dapper homolog 2, antagonist of beta-catenin (xenopus)
- dapper, antagonist of beta-catenin, homolog 2 (Xenopus laevis)
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2003-05-29
-
Entrez gene record
-
Classification
- dishevelled binding antagonist of beta catenin family
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data