Dishevelled 2 Antibody

  • Catalog number
    A02404-3
  • Price
    Please ask
  • Size
    0,1 mg
  • Target antigen
    Dishevelled 2
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species
    human, mouse, rat
  • Analyses
    WB
  • Immunogen
    A synthetic peptide corresponding to a sequence at the N-terminus of human Dishevelled 2 (35-64aa AERITLGDFKSVLQRPAGAKYFFKSMDQDF), identical to the related mouse sequence.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the Dishevelled 2 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The Dishevelled 2 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    Segment polarity protein dishevelled homolog DVL-2 is a protein that in humans is encoded by the DVL2 gene. This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40% amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.
  • Related articles
    1. Greco TL, Sussman DJ, Camper SA (January 1997). "Dishevelled-2 maps to human chromosome 17 and distal to Wnt3a and vestigial tail (vt) on mouse chromosome 11". Mamm Genome. 7 (6): 475–6. 2. Hocevar, B A; Mou F; Rennolds J L; Morris S M; Cooper J A; Howe P H (June 2003). "Regulation of the Wnt signaling pathway by disabled-2 (Dab2)". EMBO J. England. 22 (12): 3084–94.
  • Gene Name
    DVL2
  • Protein Name
    Segment polarity protein dishevelled homolog DVL-2
  • Gene Full Name
    dishevelled segment polarity protein 2
  • Synonyms
    Dishevelled-2 | Dishevelled2 | DSH homolog 2 | DVL 2 | Dvl2 | O14641
  • Uniprot ID
    O14641
  • Entrez GeneID
    1856
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
  • Gene symbol
    DVL2, DAAM2, DACT2
  • Short name
    Dishevelled 2 Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    Dishevelled 2 (antibody to-)
  • Alternative technique
    antibodies
Gene info
  • Identity
  • Gene
  • Long gene name
    dishevelled segment polarity protein 2
  • Synonyms gene name
    • dishevelled 2 (homologous to Drosophila dsh)
    • dishevelled, dsh homolog 2 (Drosophila)
  • GenBank acession
  • Locus
  • Discovery year
    1996-03-12
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • PDZ domain containing
    • Dishevelled segment polarity proteins
  • VEGA ID
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    dishevelled binding antagonist of beta catenin 2
  • Synonyms gene
  • Synonyms gene name
    • chromosome 6 open reading frame 116
    • dapper homolog 2, antagonist of beta-catenin (xenopus)
    • dapper, antagonist of beta-catenin, homolog 2 (Xenopus laevis)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2003-05-29
  • Entrez gene record
  • Classification
    • dishevelled binding antagonist of beta catenin family
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee