PCDH15 Blocking Peptide

• Catalog number
  33R-3853
• Price
  Please ask
• Size
  100 ug

• Product Type
  Proteins
• Product Subtype
  Blocking Peptides
• Research Area
  Cell Biology
• Tag Conjugate
  HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP
• Type1
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Applications
  WB, IHC
• Shipping Info
  Blue Ice
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  PCDH15  
• Gene symbol
  PCDH15
• Short name
  PCDH15 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  protocadherin-related 15 inhibiting short protein sequence
• Alternative technique
  control, peptides
• Alternative to gene target
  protocadherin-related 15, PCDH15 and IDBG-74763 and ENSG00000150275 and 65217, protein binding, Extracellular, Pcdh15 and IDBG-162009 and ENSMUSG00000052613 and 11994, PCDH15 and IDBG-637041 and ENSBTAG00000045905 and 100140108

Gene info

• Identity
  HGNC:14674
• Gene
  PCDH15
• Long gene name
  protocadherin related 15
• Synonyms gene
  • USH1F
  • DFNB23
• Synonyms gene name
  • deafness, autosomal recessive 23
  • protocadherin 15
• Synonyms
  • CDHR15
• Synonyms name
  • cadherin-related family member 15
• GenBank acession
  • AY029205
• Locus
  10q21.1
• Discovery year
  2001-02-27
• Entrez gene record
  65217
• Pubmed identfication
  • 11398101
  • 14570705
• RefSeq identity
  • NM_033056
• Classification
  • Cadherin related
  • MicroRNA protein coding host genes
• VEGA ID
  OTTHUMG00000018259
• Locus Specific Databases
  • Mutations of the Protocadherin 15 Gene
  • CCHMC-BMI & UC Hearing Loss Mutation Database

Similar products