PAR2 Antibody / F2RL1 / Thrombin Receptor-like 1

• Catalog number
  R32144
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  PAR2 / F2RL1 / Thrombin Receptor-like 1
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml
• Notes
  Optimal dilution of the PAR2 antibody should be determined by the researcher.
• Intented use
  This PAR2 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  P55085
• Purity
  Antigen affinity
• Description
  Protease activated receptor 2 (PAR2), also known ascoagulation factor II (thrombin) receptor-like 1 (F2RL1) or G-protein coupled receptor 11 (GPR11), is a protein that in humans is encoded by the F2RL1 gene. F2RL1 is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL1 is also a member of the protease-activated receptor family. It is activated by trypsin, but not by thrombin. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. The F2RL1 gene contains two exons and is widely expressed in human tissues. Additionally, PAR2 modulates inflammatory responses and acts as a sensor for proteolytic enzymes generated during infection.
• Immunogen
  Amino acids HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS of human F2RL1/PAR2 were used as the immunogen for the PAR2 antibody.
• Storage
  After reconstitution, the PAR2 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• Additional description
  The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
• French translation
  anticorps

• Gene target
  PAR2   F2RL1   Thrombin   Receptor-like  
• Gene symbol
  F2RL1, NR1I2, SLC52A1
• Short name
  Anti-PAR2 / F2RL1 / Thrombin Receptor-like 1
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to PAR2 / F2RL1 / Thrombin Receptor-like 1
• Alternative technique
  antibodies
• Alternative to gene target
  coagulation factor II (thrombin) receptor-like 1, GPR11 and PAR2, F2RL1 and IDBG-29713 and ENSG00000164251 and 2150, G-protein beta-subunit binding, Plasma membranes, F2rl1 and IDBG-173973 and ENSMUSG00000021678 and 14063, BT.28745 and IDBG-645161 and ENSBTAG00000034848 and 526525

Gene info

• Identity
  HGNC:3538
• Gene
  F2RL1
• Long gene name
  F2R like trypsin receptor 1
• Synonyms gene
  • GPR11
• Synonyms gene name
  • coagulation factor II (thrombin) receptor-like 1
• Synonyms
  • PAR2
• Synonyms name
  • proteinase-activated receptor-2
• GenBank acession
  • BC018130
• Locus
  5q13.3
• Discovery year
  1997-10-27
• Entrez gene record
  2150
• Pubmed identfication
  • 7937743
  • 7556175
• RefSeq identity
  • NM_005242
• Classification
  • F2R receptors
• VEGA ID
  OTTHUMG00000102118

Gene info

• Identity
  HGNC:7968
• Gene
  NR1I2
• Long gene name
  nuclear receptor subfamily 1 group I member 2
• Synonyms gene name
  • nuclear receptor subfamily 1, group I, member 2
• Synonyms
  • ONR1
  • PXR
  • BXR
  • SXR
  • PAR2
• Synonyms name
  • pregnane X receptor
  • orphan nuclear receptor PXR
• GenBank acession
  • AF061056
• Locus
  3q13.33
• Discovery year
  1999-04-23
• Entrez gene record
  8856
• Pubmed identfication
  • 9727070
  • 9770465
• Classification
  • Nuclear receptor subfamily 1 group I
• VEGA ID
  OTTHUMG00000159400

Gene info

• Identity
  HGNC:30225
• Gene
  SLC52A1
• Long gene name
  solute carrier family 52 member 1
• Synonyms gene
  • GPR172B
• Synonyms gene name
  • G protein-coupled receptor 172B
  • solute carrier family 52 (riboflavin transporter), member 1
• Synonyms
  • FLJ10060
  • GPCR42
  • PAR2
  • hRFT1
  • RFVT1
• Synonyms name
  • riboflavin transporter 1
• GenBank acession
  • AY070775
• Locus
  17p13.2
• Discovery year
  2004-07-19
• Entrez gene record
  55065
• Pubmed identfication
  • 12740431
  • 18632736
• RefSeq identity
  • NM_017986
• Classification
  • Solute carriers
• VEGA ID
  OTTHUMG00000099448

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products