PAGE4 Blocking Peptide

• Catalog number
  33R-7259
• Price
  Please ask
• Size
  100 µg

• Category
  Proteins
• Antibody Subtype
  Blocking Peptides
• Area of research
  Cancer
• Residues
  PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQ
• Type of protein
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• URL
• More info
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  PAGE4  
• Gene symbol
  PAGE4
• Short name
  PAGE4 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  A synthetic peptide for use as a blocking control in assays to test for specificity of PAGE4 antibody, catalog no. 70R-4588
• Alternative technique
  control, peptides

Gene info

• Identity
  HGNC:4108
• Gene
  PAGE4
• Long gene name
  PAGE family member 4
• Synonyms gene
  • GAGEC1
• Synonyms gene name
  • G antigen, family C, 1
  • P antigen family, member 4 (prostate associated)
• Synonyms
  • PAGE-4
  • CT16.7
• GenBank acession
  • AF275258
• Locus
  Xp11.23
• Discovery year
  1999-04-15
• Entrez gene record
  9506
• Pubmed identfication
  • 9724777
• Classification
  • PAGE family
• VEGA ID
  OTTHUMG00000024155

MeSH Data

• Name
  Denaturing Gradient Gel Electrophoresis
• Concept
  Scope note: Electrophoresis in which various denaturant gradients are used to induce nucleic acids to melt at various stages resulting in separation of molecules based on small sequence differences including SNPs. The denaturants used include heat, formamide, and urea.
• Tree numbers
  • E05.196.401.402.117
  • E05.301.300.319.201
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products