Otx2 Antibody

• Catalog number
  PB9344
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  Otx2
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human, mouse, rat
• Analyses
  WB
• Immunogen
  A synthetic peptide corresponding to a sequence at the C-terminus of human Otx2 (258-289aa DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL), identical to the related mouse sequence.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the Otx2 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The Otx2 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  OTX2 is also known as CPHD6 or MCOPS5. This gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). This gene is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine.
• Related articles
  1. Bunt J, et al. OTX2 sustains a bivalent-like state of OTX2-bound promoters in medulloblastoma by maintaining their H3K27me3 levels. Acta Neuropathol, 2013 Mar. 2. Gat-Yablonski G. Brain development is a multi-level regulated process--the case of the OTX2 gene. Pediatr Endocrinol Rev, 2011 Sep. 3. Liu Z, et al. Specific expression pattern of a novel Otx2 splicing variant during neural differentiation. Gene, 2013 Jul 1.
• Gene Name
  OTX2
• Protein Name
  Homeobox protein OTX2
• Gene Full Name
  orthodenticle homeobox 2
• Synonyms
  CPHD6 antibody|Homeobox protein OTX2 antibody|MCOPS 5 antibody|MCOPS5 antibody|MGC45000 antibody|Orthodenticle 2 antibody|Orthodenticle homeobox 2 antibody|Orthodenticle homolog 2 (Drosophila) antibody|Orthodenticle homolog 2 antibody|Orthodenticle2 antibody|Otx 2 antibody|otx2 antibody|OTX2_HUMAN antibody
• Uniprot ID
  P32243
• Entrez GeneID
  5015
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  Otx2  
• Gene symbol
  OTX2-AS1, OTX2, OTX2P2
• Short name
  Otx2 Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Otx2 (antibody to-)
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:43906
• Gene
  OTX2-AS1
• Long gene name
  OTX2 antisense RNA 1 (head to head)
• Synonyms gene name
  • OTX2 antisense RNA 1 (non-protein coding)
  • OTX2 antisense RNA 1
• Synonyms
  • OTX2OS1
• GenBank acession
  • BC041486
• Locus
  14q22.3
• Discovery year
  2012-05-01
• Entrez gene record
  100309464
• Pubmed identfication
  • 15703187
• RefSeq identity
  • NR_029385
• Classification
  • Antisense RNAs
• VEGA ID
  OTTHUMG00000171304

Gene info

• Identity
  HGNC:8522
• Gene
  OTX2
• Long gene name
  orthodenticle homeobox 2
• Synonyms gene name
  • orthodenticle homolog 2 (Drosophila)
• GenBank acession
  • AF298117
• Locus
  14q22.3
• Discovery year
  1994-02-08
• Entrez gene record
  5015
• Pubmed identfication
  • 7959790
• RefSeq identity
  • NM_021728.
• Classification
  • PRD class homeoboxes and pseudogenes
• VEGA ID
  OTTHUMG00000152338
• Locus Specific Databases
  • LOVD
  • LRG_718

Gene info

• Identity
  HGNC:54560
• Gene
  OTX2P2
• Long gene name
  OTX2 pseudogene 2
• Synonyms gene name
  • orthodenticle homeobox 2 pseudogene 2
• Locus
  2q22.3
• Discovery year
  2019-10-16
• Entrez gene record
  100419816
• RefSeq identity
  • NG_023739

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products