Neutrophil Elastase (ELANE) (Native Protein)

• Catalog number
  30 600 202
• Price
  Please ask
• Size
  25 µg

• Protein type
  Native
• Protein subtype
  EC 3.4.21.37
• Protein family
  Member of a serine proteases that hydrolyze many proteins in addition to elastin
• Protein description
  ELANE modifies the functions of natural killer cells, monocytes and granulocytes. Inhibits C5a-dependent neutrophil enzyme release and chemotaxis.
• Research area interests
  Diseases associated with ELANE include Neutropenia, Cyclic and Neutropenia, Severe Congenital 1, Autosomal Dominant. Among its related pathways are amb2 Integrin signaling and Cell adhesion_Cell-matrix glycoconjugates.
• Package form
  liquid
• Tested applications
  Degradation of extracellular matrix components such as elastin, cartilage proteoglycans, collagens, fibronectin; Screening and characterization of inhibitors; Drug target for emphysema, cystic fibrosis, adult respuratory stress syndrome and other diseases
• Other names
  Bone Marrow Serine Protease, Human Leukocyte Elastase, ELANE (Elastase, Neutrophil Expressed)
• Peptide sequence
  MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGMTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH
• Available target modification
  No
• Expression system
  Human Blood
• Product Subtype
  full length
• Active form
  Yes
• Tag
  untagged
• Contents
  10 mM acetate buffer pH 5.5
• Protein purity
  >95%
• Molecular weight
  29 kDa
• UniProt number
  P08246
• Gene number
  1991
• Abbreviation
  ELANE
• Full name
  elastase, neutrophil expressed
• Other desciption
  Human neutrophil elastase (EC 3.4.21.37) from human neutrophils. Prepared from whole human blood shown to be non-reactive for HbsAG, antiHCV, anti-HBc, and negative for anti-HIV1 2 by FDA approved tests. The protein consists of a single polypeptide chain of 218 amino acids I30 ... Q247 with a relative molecular weight of about 29.5 kDa.
• Purification
  Mentioned in the data sheet
• PubMed citations
  See the data sheet
• Warnings
  For Research Use only.
• Shipping conditions
  dry ice
• Storage condition
  Store at -70°C
• Technical datasheet
  Contact us to receive the datasheet
• Representative figure
• Other products

• Gene target
  Neutrophil   Elastase   ELANE   Native   Protein  
• Gene symbol
  ELANE
• Short name
  Neutrophil Elastase (ELANE) (Native Protein)
• Species
  Homo sapiens
• Alternative name
  Neutrophil Elastase (elastase, neutrophil expressed) (Native Protein)
• Alternative to gene target
  elastase, neutrophil expressed, ELA2 and GE and HLE and HNE and NE and PMN-E and SCN1, ELANE and IDBG-13111 and ENSG00000197561 and 1991, cytokine binding, Extracellular, Elane and IDBG-171367 and ENSMUSG00000020125 and 50701, ELA2 and IDBG-645525 and ENSBTAG00000046188 and 100126050

Gene info

• Identity
  HGNC:3309
• Gene
  ELANE
• Long gene name
  elastase, neutrophil expressed
• Synonyms gene
  • ELA2
• Synonyms gene name
  • elastase 2, neutrophil
• Synonyms
  • NE
  • HNE
  • HLE
  • PMN-E
• Synonyms name
  • neutrophil elastase
  • leukocyte elastase
  • medullasin
  • PMN Elastase
  • polymorphonuclear leukocyte elastase
• Locus
  19p13.3
• Discovery year
  1989-09-08
• Entrez gene record
  1991
• Pubmed identfication
  • 2902087
• RefSeq identity
  • NM_001972
• Classification
  • Granule associated serine proteases of immune defence
  • Complement system regulators and receptors
• VEGA ID
  OTTHUMG00000181839
• Locus Specific Databases
  • ELA2base: Mutation registry for Cyclic and congenital neutropenia
  • LRG_57

Similar products