NEDD8 Antibody

NEDD8 Antibody is available 1 time from Boster labs

  • Target antigen
    NEDD8
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species:
    human, mouse, rat
  • Analyses
    WB,IHC-P
  • Immunogen
    A synthetic peptide corresponding to a sequence in the middle region of human NEDD8 (20-60aa TDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK), identical to the related mouse and rat sequences.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the NEDD8 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The NEDD8 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    NEDD8 is a protein that in humans is encoded by the NEDD8 gene. Human NEDD8 shares 60% amino acid sequence identity to ubiquitin. The most substrates of NEDD8 modification are the Cullin subunits of Cullin-based E3 ubiquitin ligases, which are active only when neddylated. Their NEDDylation is critical for the recruitment of E2 to the ligase complex, thus facilitating ubiquitin conjugation. NEDD8 modification has therefore been implicated in cell cycle progression and cytoskeletal regulation.
  • Related articles
    1. Bohnsack, R. N., Haas, A. L. Conservation in the mechanism of Nedd8 activation by the human AppBp1-Uba3 heterodimer. J. Biol. Chem. 278: 26823-26830, 2003. 2. Cope, G. A., Suh, G. S. B., Aravind, L., Schwarz, S. E., Zipursky, S. L., Koonin, E. V., Deshaies, R. J. Role of predicted metalloprotease motif of Jab1/Csn5 in cleavage of Nedd8 from Cul1. Science 298: 608-611, 2002. 3. Cui, J., Yao, Q., Li, S., Ding, X., Lu, Q., Mao, H., Liu, L., Zheng, N., Chen, S., Shao, F. Glutamine deamidation and dysfunction of ubiquitin/NEDD8 induced by a bacterial effector family. Science 329: 1215-1218, 2010.
  • Gene Name
    NEDD8
  • Protein Name
    NEDD8
  • Gene Full Name
    neural precursor cell expressed, developmentally down-regulated 8
  • Synonyms
    NED8 | NEDD 8 | NEDD-8 | Nedd8 | Neddylin | Rub1 | Q15843
  • Uniprot ID
    Q15843
  • Entrez GeneID
    4738
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
  • Short name
    NEDD8 Antibody
  • Technique
    Antibody
  • Alternative name
    NEDD8 (Antibody to)
  • Alternative technique
    antibodies

A00547 | NEDD8 Antibodysize: 0,1 mg | 436.65 USD

Ajax processing
Simillar products
Supplier:Epigen
Price:647.96USD
Supplier:Bioss Primary Unconjugated Antibodies
Price:307.05USD
Supplier:Assay Biotech
Price:379.44USD
Supplier:aviva
Price:495.02USD
Supplier:Cusabio
Price:196.14USD
Supplier:abbex
Price:115.58USD
Supplier:fitzgerald
Price:454.16USD
Supplier:NJS poly
Price:232.33USD
Supplier:EnoGene
Price:344.41USD
Supplier:MyBioSource
Price:0.00USD
Supplier:Biochempeg
Price:782.23USD
Supplier:BlueGen ELISAs
Price:706.34USD
Supplier:ABM microrna
Price:295.38USD
Supplier:MyBioSource
Price:0.00USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
NEDD8 Antibody - Gentaur.com
Contact
Chat with gentaur.com employee