NEDD8 Antibody

NEDD8 Antibody is available 1 time from Boster labs

  • Clonality
    Polyclonal antibody
  • Entrez GeneID
    4738
  • Analyses
    WB,IHC-P
  • Related articles
    1. Bohnsack, R. N., Haas, A. L. Conservation in the mechanism of Nedd8 activation by the human AppBp1-Uba3 heterodimer. J. Biol. Chem. 278: 26823-26830, 2003. 2. Cope, G. A., Suh, G. S. B., Aravind, L., Schwarz, S. E., Zipursky, S. L., Koonin, E. V., Deshaies, R. J. Role of predicted metalloprotease motif of Jab1/Csn5 in cleavage of Nedd8 from Cul1. Science 298: 608-611, 2002. 3. Cui, J., Yao, Q., Li, S., Ding, X., Lu, Q., Mao, H., Liu, L., Zheng, N., Chen, S., Shao, F. Glutamine deamidation and dysfunction of ubiquitin/NEDD8 induced by a bacterial effector family. Science 329: 1215-1218, 2010.
  • Raised in
    rabbit
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Target antigen
    NEDD8
  • Immunogen
    A synthetic peptide corresponding to a sequence in the middle region of human NEDD8 (20-60aa TDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK), identical to the related mouse and rat sequences.
  • Type of the antibody
    IgG polyclonal antibody
  • Uniprot ID
    Q15843
  • Clone
    Polyclonal antibody
  • Protein Name
    NEDD8
  • Synonyms
    NED8 | NEDD 8 | NEDD-8 | Nedd8 | Neddylin | Rub1 | Q15843
  • Storage condtions
    Keep the NEDD8 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Purification
    Immunogen affinity purified.
  • Background
    NEDD8 is a protein that in humans is encoded by the NEDD8 gene. Human NEDD8 shares 60% amino acid sequence identity to ubiquitin. The most substrates of NEDD8 modification are the Cullin subunits of Cullin-based E3 ubiquitin ligases, which are active only when neddylated. Their NEDDylation is critical for the recruitment of E2 to the ligase complex, thus facilitating ubiquitin conjugation. NEDD8 modification has therefore been implicated in cell cycle progression and cytoskeletal regulation.
  • Product form
    freeze-dried
  • Gene Name
    NEDD8
  • Gene Full Name
    neural precursor cell expressed, developmentally down-regulated 8
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Reacts with species:
    human, mouse, rat
  • Tips
    The NEDD8 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Gene target
  • Short name
    NEDD8 Antibody
  • Technique
    Antibody
  • Alternative name
    NEDD8 (Antibody to)
  • Alternative technique
    antibodies

A00547 | NEDD8 Antibodysize: 0,1 mg | 459.98 USD

Ajax processing
Simillar products
Supplier:MBS Polyclonals
Price:741.63USD
Supplier:ABM lentivectors
Price:737.94USD
Supplier:MBS Polyclonals
Price:421.86USD
Supplier:Bioss Primary Unconjugated Antibodies
Price:323.46USD
Supplier:ABM microrna
Price:1 601.33USD
Supplier:MBS Recombinant
Price:2 012.12USD
Supplier:genways bulk
Price:0.00USD
Supplier:MBS Recombinant
Price:2 208.90USD
Supplier:fitzgerald
Price:402.18USD
Supplier:genways bulk
Price:0.00USD
Supplier:abbex
Price:1 382.41USD
Supplier:Reliatech antibodies
Price:413.25USD
Supplier:ABM microrna
Price:311.16USD
Supplier:proscience
Price:221.38USD
Supplier:abbex
Price:373.89USD
Supplier:ABM microrna
Price:2 676.26USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
NEDD8 Antibody - Gentaur.com
Contact
Chat with gentaur.com employee