Mycobacterium bovis BCG Recombinant HSP65 Protein

Mycobacterium bovis BCG Recombinant HSP65 Protein is available 3 times from Stressmark proteins labs

  • Origin
    Recombinant
  • Other name
    60kDa chaperonin 2 Protein, Antigen A Protein, Cell wall protein A Protein, groEL Protein, GroEL2 Protein, GroL2 Protein, M. Tuberculosis cell wall protein A Protein, M. Tuberculosis HSP65 Protein, Protein Cpm60 2 Protein
  • PubMed number
    27742830, 17920518, 26925118, 25463133, 24066722
  • Category
    Protein
  • Recommended buffer for storage
    20mM Tris, 150mM NaCl, 10% glycerol
  • Protein purification
    Multi-Step Purified
  • Protein origin
    Canada
  • Stock availability
    In Stock
  • Representative figure legend
    SDS-PAGE of 65kDa M. Bovis Hsp65 protein (SPR-116). SDS-Page of M. Bovis HSP65 Protein (SPR-116)
  • Protein concentration
    Lot/batch specific. See included datasheet.
  • Protein description
    Mycobacterium bovis BCG Recombinant HSP65 Partial Protein
  • NCBI number
    AAQ64501.1
  • Protein target
    HSP65
  • Protein reactivity
    Mycobacterium bovis BCG
  • Purity pourcentage
    >90% High purity
  • Tested species reactivity
    Human, Mouse, M. bovis
  • Supplementary useful information
    Please see included datasheet or contact us
  • Protein number
    Q1EHB9
  • Primary research area
    Cancer, Heat Shock
  • Protein specificity
    ~65 kDa
  • Protein tag
    No tag
  • Tested applications
    Functional Assay, Functional Assay, ELISA, Functional Assay, Western Blot Control
  • Total weight (kg)
    1.4
  • Release date
    1-May-2008
  • Scientific context
    HSP65 isolated from Mycobacterium bovis BCG, is a member of the HSP60 family of heat shock proteins (2, 3). HSP60s are mitochondrial chaperonins that are typically held responsible for the transportation and refolding of proteins from the cytoplasm into the mitochondrial matrix. In addition to its role as a heat shock protein, HSP60 functions as a chaperonin to assist in folding linear amino acid chains into their respective three-dimensional structure. HSP60s are a ubiquitous class of HSPs that specifically promote the folding and assembly of cellular polypeptides in an ATP-dependent manner (1). Specifically, sequence comparison of HSP65 from different mycobacterium strains showed that the protein sequence of M. bovis BCG is identical to that of M. tuberculosis, and very similar to that of M. leprae, the pathogens that cause tuberculosis and tuberculoid leprosy, respectively (2,4). Mycobacterium bovis BCG HSP65 was identified as the immunodominant antigen during mycobacterial diseases and vaccination. It is also believed to be the antigen that induces autoimmune disease, such as adjuvant arthritis in rats (5, 6).
  • Certificate of analysis
    This product has been certified >90% pure using SDS-PAGE analysis.
  • Brand name
    none
  • Peptide sequence
    EDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPLGLKRGIEKAVEKVTETLLKGAKEVETKEQIAATAAISAGDQSIGDLIAEAMDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISGYFVTDPERQEAVLEDPYILLVSSKVSTVKDLLPLXXXXXXXGKPLLIIAEDVEGEALSTLV
  • Protein expression model
    E. coli
  • Protein cell localization
    Cytoplasm
  • Warnings
    Non-hazardous materials
  • Protein charasterics
    Partial
  • Bibliography
    1. Koll H., et al. (1992) Cell. 68: 1163-1175. 2. Thole J.E.R., et al. (1985) Infect. Immuno. 50: 800-806. 3. Thole J.E.R., et al., (1987) Infect. Immuno. 55: 1466-1475. 4. Shinnick T.M. Sweetser D., Thole J., van Embden J. and Young R.A. (1987) Infect. Immuno. 55: 1932-1935. 5. Van Eden W., et al. (1988) Nature 331: 171-178. 6. Cobelens P.M., et al. (2002) Rheumatology 41: 775-779.
  • Verified applications
    WB, SDS-PAGE, Functional Assay, ELISA
  • Storage recommendations
    -20°C
  • Shipping recommendations
    Blue Ice or 4°C
  • Gene target
  • Short name
    Mycobacterium bovis BCG Recombinant HSP65 Protein
  • Technique
    Recombinant
  • Alternative name
    Mycobacterium bovis BCG recombinant HSP65 Protein
  • Alternative technique
    rec

SPR-116A | Mycobacterium bovis BCG Recombinant HSP65 Proteinsize: 50 µg | 329.61 USD

Ajax processing

SPR-116B | Mycobacterium bovis BCG Recombinant HSP65 Proteinsize: 100 µg | 441.53 USD

Ajax processing

SPR-116C | Mycobacterium bovis BCG Recombinant HSP65 Proteinsize: 2x100 µg | 780.99 USD

  • Net weight (g)
    0.2
  • Disease
    mycobacterium
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
MeSH Data
  • Name
  • Concept
    Scope note:The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    classification, economics, history, instrumentation, methods, standards, trends, utilization, veterinary, statistics & numerical data, ethics
Additional information
Simillar products
Supplier:proscience
Price:221.38USD
Supplier:MBS Recombinant
Price:1 977.68USD
Supplier:Molekula
Price:76.25USD
Supplier:fitzgerald
Price:509.18USD
Supplier:ABM lentivectors
Price:396.64USD
Supplier:fabgen
Price:439.57USD
Supplier:abbex
Price:121.76USD
Supplier:Bioss Primary Unconjugated Antibodies
Price:345.60USD
Supplier:abbex
Price:730.56USD
Supplier:MBS Monoclonals
Price:428.01USD
Supplier:aviva
Price:285.34USD
Supplier:ABM CrispR
Price:7 159.25USD
Supplier:fitzgerald
Price:705.96USD
Supplier:acr
Price:686.28USD
Supplier:acr
Price:774.84USD
Supplier:Elabscience
Price:698.58USD
Supplier:SFC
Price:0.00USD
Supplier:aviva
Price:521.48USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Mycobacterium bovis BCG Recombinant HSP65 Protei|gentaur.com
Contact
Chat with gentaur.com employee