Musashi 1/Msi1 Antibody

• Catalog number
  A05052-1
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  Musashi 1/Msi1
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  rat Theoretical reactivity:human
• Analyses
  WB,IHC-P
• Immunogen
  A synthetic peptide corresponding to a sequence at the N-terminus of human Musashi 1/Msi1 (21-54aa KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD), identical to the related mouse and rat sequences.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the Musashi 1/Msi1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The Musashi 1/Msi1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.
• Related articles
  1. Good P, Yoda A, Sakakibara S, Yamamoto A, Imai T, Sawa H, Ikeuchi T, Tsuji S, Satoh H, Okano H (Dec 1998). "The human Musashi homolog 1 (MSI1) gene encoding the homologue of Musashi/Nrp-1, a neural RNA-binding protein putatively expressed in CNS stem cells and neural progenitor cells". Genomics. 52 (3): 382–4.
• Gene Name
  MSI1
• Protein Name
  RNA-binding protein Musashi homolog 1
• Gene Full Name
  musashi RNA binding protein 1
• Synonyms
  Msi 1 | Msi1 | Musashi-1 | Musashi1 | O43347
• Uniprot ID
  O43347
• Entrez GeneID
  4440
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  Musashi   1/Msi1  
• Gene symbol
  MSI1
• Short name
  Musashi 1/Msi1 Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Musashi 1/Msi1 (antibody to-)
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:7330
• Gene
  MSI1
• Long gene name
  musashi RNA binding protein 1
• Synonyms gene name
  • Musashi (Drosophila) homolog 1
  • musashi homolog 1 (Drosophila)
• GenBank acession
  • AB012851
• Locus
  12q24.31
• Discovery year
  1998-05-07
• Entrez gene record
  4440
• Pubmed identfication
  • 9790759
• RefSeq identity
  • NM_002442
• Classification
  • RNA binding motif containing
• VEGA ID
  OTTHUMG00000169344

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products