MMP 9 Monomer (Progelatinase B) (Native Protein)

  • Catalog number
    30 100 502
  • Price
    Please ask
  • Size
    10 µg/ 200µl
  • Protein type
    Native
  • Protein subtype
    EC 3.4.24.35
  • Protein family
    Matrix Metalloproteinases, matrixins
  • Protein description
    MMP9 may play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly- -Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.
  • Research area interests
    Diseases associated with MMP9 include Metaphyseal Anadysplasia 2 and Metaphyseal Anadysplasia. Among its related pathways are Pathways in cancer and Integrin Pathway.
  • Package form
    liquid
  • Tested applications
    Degradation of extracellular Matrix; Screening and evaluation of MMP inhibitors; Antigen standard
  • Other names
    Matrix Metalloproteinase 9, Gelatinase B, 92kDa Gelatinase, 92kDa Type IV Collagenase
  • Peptide sequence
    MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
  • Available target modification
    Yes
  • Expression system
    Human Blood
  • Product Subtype
    full length
  • Active form
    Yes, after Trypsin activation
  • Tag
    untagged
  • Contents
    50 mM Tris-HCl, pH 7.0, 200 mM NaCl, 5 mM CaCl2, 1 μM ZnCl2, 0.05 % Brij-35, 0.05 % NaN3
  • Protein purity
    > 95%
  • Molecular weight
    92 kDa
  • UniProt number
    P14780
  • Gene number
    4318
  • Abbreviation
    MMP9
  • Full name
    matrix metallopeptidase 9
  • Other desciption
    Progelatinase B monomer is isolated from human blood. The preparation is free from gelatinase B dimer and from complexes of gelatinase B with TIMP-1 or lipocalin.
  • Purification
    Mentioned in the data sheet
  • PubMed citations
    See the data sheet
  • Warnings
    For Research Use only.
  • Shipping conditions
    dry ice
  • Storage condition
    Store at -70°C
  • Technical datasheet
    Contact us to receive the datasheet
  • Gene target
  • Gene symbol
    MMP14, MMP24, MMP28, MMP17, MMP15, MMP25, MMP16
  • Short name
    MMP 9 Monomer (Progelatinase B) (Native Protein)
  • Species
    Homo sapiens
  • Alternative name
    MMP 9 Monomer (Progelatinase B) (Native Protein)
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    matrix metallopeptidase 17
  • Synonyms gene name
    • matrix metalloproteinase 17 (membrane-inserted)
    • matrix metallopeptidase 17 (membrane-inserted)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1996-11-13
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • M10 matrix metallopeptidases
  • VEGA ID
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    matrix metallopeptidase 16
  • Synonyms gene
  • Synonyms gene name
    • matrix metalloproteinase 16 (membrane-inserted)
    • chromosome 8 open reading frame 57
    • matrix metallopeptidase 16 (membrane-inserted)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1996-11-13
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • M10 matrix metallopeptidases
  • VEGA ID
Similar products
Filters
Contact
Chat with gentaur.com employee